KEGG   Macaca fascicularis (crab-eating macaque): 101926436
Entry
101926436         CDS       T02918                                 

Gene name
UNG
Definition
(RefSeq) uracil DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf03410  Base excision repair
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101926436 (UNG)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    101926436 (UNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcf03400]
    101926436 (UNG)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     101926436 (UNG)
DNA repair and recombination proteins [BR:mcf03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     101926436 (UNG)
 Prokaryotic type
     101926436 (UNG)
SSDB
Motif
Pfam: UDG Toxin_ToxA
Other DBs
NCBI-GeneID: 101926436
NCBI-ProteinID: NP_001270246
UniProt: Q4R4X0
Position
11
AA seq 304 aa
MGVFCLGPWGLGQKLRTPGKRPLQLLSRLCGDPLQANPPKKAPAAQEEPGTPPSSPLSAE
QLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYP
PPHQVFTWTQMRDIRDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTD
IEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGL
VFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPID
WKEL
NT seq 915 nt   +upstreamnt  +downstreamnt
atgggcgtcttctgccttgggccgtgggggttgggccagaagctgcggactcctgggaag
cggcctctgcagctcttgagccgcctctgcggggaccccttgcaggccaacccccccaag
aaggccccggccgcgcaggaggagcccgggacgccgccctcctcgccgctgagtgctgag
cagttggaccggatccagaggaacaaggccgcggccctgctcagacttgcggcccgcaac
gtgcccgtgggctttggggagagctggaagaagcacctcagcggggagttcggaaaaccg
tattttatcaagctaatgggatttgttgcagaagaaagaaagcattacactgtttatcca
cccccacaccaagtcttcacctggacccagatgcgtgacataagagatgtgaaggttgtc
atcctgggacaggatccgtatcatggacctaatcaagctcacgggctctgctttagtgtt
caaaggcctgttccgcctccgcccagtttggagaacatttataaagagctgtctacagac
atagaggattttgttcatcctggccatggagatttatctggatgggccaagcaaggtgtt
ctcctactcaacgctgtcctcacggttcgggcccatcaagccaactctcataaggagaga
ggctgggagcaattcaccgatgcagttgtatcctggctaaatcagaactcaaatggcctt
gttttcttgctctggggctcttatgctcagaagaagggcagtgccatcgataggaagcgg
caccatgtactacagacggctcatccctcccctttgtcagtgtatagagggttctttgga
tgtagacacttttcaaagactaatgagctgctgcagaagtctggcaagaagcccatcgac
tggaaggagctgtga

DBGET integrated database retrieval system