KEGG   Macaca fascicularis (crab-eating macaque): 101926720Help
Entry
101926720         CDS       T02918                                 

Gene name
NT5C2
Definition
(RefSeq) 5'-nucleotidase, cytosolic II
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00230  Purine metabolism
mcf00240  Pyrimidine metabolism
mcf00760  Nicotinate and nicotinamide metabolism
mcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101926720 (NT5C2)
   00240 Pyrimidine metabolism
    101926720 (NT5C2)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    101926720 (NT5C2)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     101926720 (NT5C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 101926720
NCBI-ProteinID: XP_005566389
Position
9
AA seq 569 aa AA seqDB search
MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVY
KSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLV
CAHGFNFIRGSQVAVQKRPETREQYPNKFIQRDDTERFYILNTLFNLPETYLLACLVDFF
TNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKYVVKDGKL
PLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARK
PLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIGDH
IFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNE
RPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYP
FSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIK
PPNLFPLAPQEITHCHDEDDDEEEEEEEE
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacctcttggagtgatcgattgcagaatgcagcagatatgcctgctaacatggat
aagcatgccctgaaaaagtatcgtcgagaagcctatcatcgggtgtttgtgaaccgaagt
ttagccatggaaaagataaagtgttttggttttgatatggattatacccttgctgtgtac
aagtccccggagtatgagtcccttggttttgagcttactgtggagagattagtttctatt
ggctatccccaggagttgctcagctttgcttatgattctacattccctaccaggggactt
gtctttgacacactatatggaaatcttttgaaagtcgatgcctatggaaacctcttggtc
tgtgcacatggatttaactttataaggggttctcaggtagctgttcaaaagagaccagaa
actagagaacagtatccaaataaatttatccagcgagatgatactgaaagattttacatt
ctgaacacactattcaacctaccagagacctacctgttggcctgcctagtagattttttt
actaattgtcccagatataccagttgtgagacaggatttaaagatggggacctcttcatg
tcctaccggagtatgttccaggatgtaagagatgctgttgactgggttcattacaagggc
tcccttaaggaaaagacagttgaaaatcttgagaagtatgtagtcaaagatggaaaactg
cctttgcttctgagccggatgaaggaagtagggaaagtatttcttgctaccaacagtgac
tataaatatacagataaaattatgacttacctgtttgacttcccacatggccccaagcct
gggagctcccatcgaccatggcagtcctactttgacctgatcttggtggatgcacggaaa
ccactcttttttggagaaggcacagtactgcgtcaagtggatactaaaactggcaagctg
aaaattggtacctacacaggccccctacagcatggtatcgtctactcaggaggttcttct
gatacgatctgtgatctgctgggagccaagggaaaagacattttgtatattggagatcac
atttttggggacattttaaaatcaaagaaacggcaagggtggcgaacttttttggtgatt
cccgaacttgcacaggagctgcatgtctggaccgacaagagttcacttttcgaagaactt
cagagcttggatattttcttggctgaactctacaagcaccttgacagcagtagcaatgag
cgtccagacattagttccatccagagacgtattaagaaagtaactcatgacatggacatg
tgctatgggatgatgggaagcctgtttcgcagtggctcccggcagaccctttttgccagt
caagtgatgcgttacgctgacctctatgcagcatctttcatcaacctgctgtattaccca
ttcagctacctcttcagggctgcccatgtcttgatgcctcatgaatcaacggtggagcac
acacacgtagatatcaatgagatggagtctcctcttgccacccggaaccgcacatcagtg
gatttcaaagacactgactacaagcggcaccagctgacacggtcaattagtgagattaaa
cctcccaacctcttcccactggccccccaggaaattacacactgccatgatgaagatgat
gatgaagaggaggaggaggaggaagaataa

DBGET integrated database retrieval system