KEGG   Macaca fascicularis (crab-eating macaque): 101926770Help
Entry
101926770         CDS       T02918                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf04010  MAPK signaling pathway
mcf04015  Rap1 signaling pathway
mcf04068  FoxO signaling pathway
mcf04071  Sphingolipid signaling pathway
mcf04114  Oocyte meiosis
mcf04218  Cellular senescence
mcf04261  Adrenergic signaling in cardiomyocytes
mcf04370  VEGF signaling pathway
mcf04380  Osteoclast differentiation
mcf04550  Signaling pathways regulating pluripotency of stem cells
mcf04611  Platelet activation
mcf04620  Toll-like receptor signaling pathway
mcf04621  NOD-like receptor signaling pathway
mcf04622  RIG-I-like receptor signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04657  IL-17 signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf04668  TNF signaling pathway
mcf04670  Leukocyte transendothelial migration
mcf04714  Thermogenesis
mcf04722  Neurotrophin signaling pathway
mcf04723  Retrograde endocannabinoid signaling
mcf04728  Dopaminergic synapse
mcf04750  Inflammatory mediator regulation of TRP channels
mcf04912  GnRH signaling pathway
mcf04914  Progesterone-mediated oocyte maturation
mcf04917  Prolactin signaling pathway
mcf04926  Relaxin signaling pathway
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04935  Growth hormone synthesis, secretion and action
mcf05014  Amyotrophic lateral sclerosis (ALS)
mcf05132  Salmonella infection
mcf05133  Pertussis
mcf05135  Yersinia infection
mcf05140  Leishmaniasis
mcf05142  Chagas disease (American trypanosomiasis)
mcf05145  Toxoplasmosis
mcf05152  Tuberculosis
mcf05161  Hepatitis B
mcf05163  Human cytomegalovirus infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05205  Proteoglycans in cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101926770 (MAPK14)
   04010 MAPK signaling pathway
    101926770 (MAPK14)
   04370 VEGF signaling pathway
    101926770 (MAPK14)
   04668 TNF signaling pathway
    101926770 (MAPK14)
   04068 FoxO signaling pathway
    101926770 (MAPK14)
   04071 Sphingolipid signaling pathway
    101926770 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101926770 (MAPK14)
   04218 Cellular senescence
    101926770 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101926770 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101926770 (MAPK14)
   04620 Toll-like receptor signaling pathway
    101926770 (MAPK14)
   04621 NOD-like receptor signaling pathway
    101926770 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    101926770 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    101926770 (MAPK14)
   04660 T cell receptor signaling pathway
    101926770 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    101926770 (MAPK14)
   04659 Th17 cell differentiation
    101926770 (MAPK14)
   04657 IL-17 signaling pathway
    101926770 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    101926770 (MAPK14)
   04670 Leukocyte transendothelial migration
    101926770 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101926770 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    101926770 (MAPK14)
   04917 Prolactin signaling pathway
    101926770 (MAPK14)
   04926 Relaxin signaling pathway
    101926770 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    101926770 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101926770 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    101926770 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    101926770 (MAPK14)
   04722 Neurotrophin signaling pathway
    101926770 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101926770 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101926770 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    101926770 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101926770 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101926770 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    101926770 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101926770 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101926770 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101926770 (MAPK14)
   05135 Yersinia infection
    101926770 (MAPK14)
   05133 Pertussis
    101926770 (MAPK14)
   05152 Tuberculosis
    101926770 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101926770 (MAPK14)
   05161 Hepatitis B
    101926770 (MAPK14)
   05163 Human cytomegalovirus infection
    101926770 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101926770 (MAPK14)
   05169 Epstein-Barr virus infection
    101926770 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101926770 (MAPK14)
   05140 Leishmaniasis
    101926770 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    101926770 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101926770 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    101926770 (MAPK14)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101926770 (MAPK14)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101926770 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 101926770
NCBI-ProteinID: XP_005553248
UniProt: A0A2K5WK50 G7P3B2
Position
4
AA seq 360 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVVSFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctccggcgcctatggctctgtgtgtgcc
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggcacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgacgcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcagcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcgtcagctttgtgccaccgcccctcgaccaagaagagatggagtcc
tga

DBGET integrated database retrieval system