KEGG   Macaca fascicularis (crab-eating macaque): 102115057Help
Entry
102115057         CDS       T02918                                 

Gene name
H6PD
Definition
(RefSeq) hexose-6-phosphate dehydrogenase/glucose 1-dehydrogenase
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00030  Pentose phosphate pathway
mcf01100  Metabolic pathways
mcf01200  Carbon metabolism
Module
mcf_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mcf_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102115057 (H6PD)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     102115057 (H6PD)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     102115057 (H6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso G6PD_C G6PD_N DUF5617
Motif
Other DBs
NCBI-GeneID: 102115057
NCBI-ProteinID: XP_005544913
UniProt: A0A2K5W883
Position
1
AA seq 802 aa AA seqDB search
MLAEPFYWHPGMWKMLIVVMCVALLGCLQAQELQEHVSIILLGATGDLAKKYLWQGLFQL
YLDEVGRGHSFSFHGAALTAPKQGQELMAKALESLSCPKDMAPSHCAEEKDQFLQLSRYR
QLKTAEDYQALNKDIEAQLQHAGLREAGRIFYFSVPPFAYADIARNINSSCRPGPGAWLR
VVLEKPFGHDHFSAQQLATELGSFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDSLW
NRHHVERVEIIMKETVDAEGRTSFYEEYGVIRDVLQNHLTEVLTLVAMELPLNVSSAEAV
LRHKLQVFQALRGLQRGSAVVGQYQSYSEQVRRELQKPDSFHSLTPTFAAVLVHIDNLRW
EGVPFILMSGKALDERVGYARILFKNQACCVQSEKHWAAAQSQCLPRQLIFHIGHGDLGS
PAVLVSRNLFRPSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVQERDAHSVLLSHIFHGR
KDSFITTENLLASWGFWTPLLESLAHKAPRLYPGGAENGRLLDFEFSSGRLFFSQQQPEQ
LVPGPGPAPMPSDFQVLRAKYRESPLVSAWSEELISKLANDIEATAVRAVRRFGQFHLAL
SGGSSPVALFQQLATAHYGFPWAHTHLWLVDERCVPLSDPESNFQGLQAHLLQHVRVPYY
NIHPMPVHLQQRLCAEEDQGAQIYAREISALVANSSFDLVLLGMGADGHTASLFPQSPTG
LDGEQLVVLTTSPSQPHRRMSLSLPLINRAKKVAVLVMGRMKREITALVSRVGYEPKKWP
ISGVLPHSGQLVWYMDYDAFLA
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgttagcagagcctttttactggcacccaggcatgtggaagatgctcatagtggtgatg
tgcgtggcccttctgggctgcctgcaggcccaggagctccaggaacatgtctccataatc
ctgctgggagccactggggacctggctaagaagtacttatggcagggactgttccagctg
tacctggatgaagtggggaggggccacagttttagcttccatggagctgctctgacagcc
cccaagcagggccaagagctcatggccaaggccctggaatccctctcctgccccaaggac
atggcaccaagtcactgtgcagaggaaaaggatcagttcctgcagctgagccggtaccgc
caactgaagacggccgaggactatcaggccctgaacaaggacatcgaggcacagctccag
cacgcaggcctccgggaggctggcaggatcttctacttctcggtgccacccttcgcctat
gcagacattgcccgcaacatcaacagcagctgccggccaggcccgggcgcctggctgcgg
gttgtccttgagaaaccctttggccatgaccacttctcagctcagcagctggccacagaa
ctcgggagctttttccaggaggaggagatgtaccgggtggaccattacttgggcaagcag
gccgtggcccagatcctgcctttccgagaccagaaccgcaaggctttggacagcctctgg
aaccggcaccacgtggagcgggtggagatcatcatgaaagagaccgtggatgccgaaggc
cgcaccagcttctatgaggagtatggtgtcattcgcgacgtcctccagaaccatctgacg
gaggtcctcaccctcgtggccatggagctgcccctcaatgtcagcagtgcggaggctgtg
ctgcggcacaagcttcaggtcttccaggcgctgcggggcctgcagaggggcagtgccgtc
gtgggccagtaccagtcttacagtgagcaggtgcgcagagagctgcagaagccagacagc
ttccacagcctgacgccgaccttcgcagccgttctcgtgcacatcgacaatcttcgctgg
gagggcgtgcctttcatcttgatgtctggcaaagccttggacgagagagtgggctacgct
cggatcttgttcaagaaccaggcctgctgcgtgcagagcgaaaagcactgggctgcggca
cagagccagtgcctgcctcggcagctcatcttccacatcggccacggcgacctgggcagc
cccgccgtgctggtcagcaggaacctgttcaggccctccctgccctccagctggaaggaa
atggagggcccacctgggctccgccttttcggcagccctctgtccgattactacgcctac
agccccgtgcaggagcgggacgcccactctgtcctcttatcccatatcttccatggccgg
aaggattccttcatcaccacagagaacttgctggcctcctggggcttctggacccctctg
ctggagagcctggcccataaggccccacgcctctatcctggaggagctgagaacggccgt
ctgttggactttgagttcagtagcggccggttgttcttttcccagcagcagccggagcag
ctagtgccagggccagggccggccccaatgcccagtgacttccaggtcctcagggccaag
taccgagagagcccgctggtctccgcctggtccgaggagctgatctctaagctggctaac
gacattgaggccactgctgtgcgggccgtgcggcgctttggccagttccacctggcgctg
tcagggggctccagccccgtggccctgttccagcagctggccacggcacactacggcttc
ccctgggcccacacgcacctgtggctggttgacgagcgctgcgtcccgctctcggacccg
gagtccaacttccagggcctgcaggcccacctgctgcagcacgtccgggtcccctactac
aacatccaccccatgcctgtgcacctgcagcagcggctctgcgccgaggaggaccagggc
gcccagatctacgccagggagatctcagccctggtggccaatagcagcttcgacctggtg
ctgctgggcatgggtgccgacgggcacacagcctcccttttcccacagtcgcccactggc
ctggacggcgagcagctggtcgtgctgaccacgagcccctcccagccacaccgccgcatg
agccttagcctgcctctcatcaaccgtgccaagaaggtggcagtcctagtcatgggcagg
atgaagcgtgagatcaccgcgctggtgagccgggtgggctatgagcccaagaagtggccc
atctcgggtgtcctgccgcactctggccaactggtgtggtacatggactacgacgccttc
ctggcatga

DBGET integrated database retrieval system