KEGG   Macaca fascicularis (crab-eating macaque): 102115567Help
Entry
102115567         CDS       T02918                                 

Gene name
ASB13
Definition
(RefSeq) ankyrin repeat and SOCS box containing 13
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcf04121]
    102115567 (ASB13)
Ubiquitin system [BR:mcf04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102115567 (ASB13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_3 Ank_5 SOCS_box
Motif
Other DBs
NCBI-GeneID: 102115567
NCBI-ProteinID: XP_005564613
Position
9
AA seq 454 aa AA seqDB search
MFAHACTGHACTGHMHRMHVLYRTHVLHLETHIHGLHRDTGPHACNGYMFTHGRMFCTGH
MHRMHVLHMDTHMFTQDKCTGHVLHRTHSLHGTHGLQMQARTLLGATDEARWQRQRSRDA
RTAPPGTTPRRRELQFPARWPRADARPSADWPRPAAPRSLAQVPAPRVAARPRVSRMEPR
AADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQ
ARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEA
CMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHET
ALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCLEYYEKTPLTLSQ
LCRVSLRKATGVRGLEKIAKLNIPPRLIDYLSYN
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcacacgcttgcacaggacacgcttgcacaggacacatgcacaggatgcatgtt
ttgtacaggacacatgttttgcacttggaaacacatatccatggtttgcacagggacaca
gggccgcatgcttgcaatggatacatgtttacacacggacgcatgttttgcacagggcat
atgcacaggatgcatgttttgcacatggacacacacatgtttacacaggacaagtgcaca
ggacacgttttgcaccggacgcattctttgcacgggacgcacggtttgcagatgcaagca
cgcacactcctcggcgcgacggacgaagcccggtggcagcgacagcggagtcgggacgca
aggacagcgcctccgggaaccacgccaaggcggcgggaactacaattcccggctcggtgg
cctcgggccgacgcgcgtcccagcgcagactggccccgcccagcggccccgcgcagcctg
gcccaggtcccagcgcccagagtagccgcgcggccgcgggtgagccgcatggagccccgg
gcggcggacggctgcttcctgggcgacgttggtttctgggtggaacggacccctgtgcac
gaggcagcccagcggggtgagagcctgcagctgcaacagctgatcgagagtggcgcctgt
gtgaaccaggtcactgtggactccatcacgcccctgcacgcggccagtctgcagggccag
gcgcggtgcgtgcagctgctgctggcggctggggcccaggtggatgctcgcaacatcgat
ggcagcaccccgctctgcgatgcctgcgcctcgggcagcatcgagtgtgtgaagctcttg
ctgtcctatggggccaaggtcaaccctcctttgtacacagcatcccccctgcacgaggcc
tgcatgagtgggagttccgaatgtgtgaggcttcttattgatgttggggccaatctggaa
gcgcacgattgccattttgggacccctctgcacgttgcctgtgcccgggagcatctggac
tgtgtcaaagtgctgctcaatgcaggggccaacgtgaacgcggcaaagcttcatgagacg
gcccttcaccacgcggccaaggtcaagaatgttgacctcatcgagatgcttatcgagttt
ggcggcaacatctacgcccgggacaaccgtgggaagaagccgtctgactacacgtggagc
agcagcgctcccgccaagtgcctggagtactacgaaaagacacctctgactctgtcgcaa
ctctgcagggtgagcttgaggaaggccactggcgtccgagggctggagaagatcgccaag
ttaaacatcccaccccggctcattgattacctctcctacaactga

DBGET integrated database retrieval system