KEGG   Macaca fascicularis (crab-eating macaque): 102116047
Entry
102116047         CDS       T02918                                 

Gene name
PTPRC
Definition
(RefSeq) protein tyrosine phosphatase, receptor type C
  KO
K06478  receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04514  Cell adhesion molecules
mcf04660  T cell receptor signaling pathway
mcf04666  Fc gamma R-mediated phagocytosis
mcf05132  Salmonella infection
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102116047 (PTPRC)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102116047 (PTPRC)
   04666 Fc gamma R-mediated phagocytosis
    102116047 (PTPRC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102116047 (PTPRC)
  09163 Immune disease
   05340 Primary immunodeficiency
    102116047 (PTPRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcf01009]
    102116047 (PTPRC)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102116047 (PTPRC)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102116047 (PTPRC)
Protein phosphatases and associated proteins [BR:mcf01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    102116047 (PTPRC)
CD molecules [BR:mcf04090]
 Proteins
  102116047 (PTPRC)
SSDB
Motif
Pfam: Y_phosphatase CD45 fn3 PTP_N Y_phosphatase3 PTPlike_phytase DSPc GnsAB_toxin
Other DBs
NCBI-GeneID: 102116047
NCBI-ProteinID: XP_005540386
UniProt: A0A2K5VQ76
Position
1
AA seq 1310 aa
MTMCLWLKLLAFVFAFLDTEVFVTGQGSTLSPTGRRTTKMPSVPLSSDPLPTHTTAFSPA
SISERENDFSETTPSLSSDNTSTQVSPDSLDNASAFNTTGVSSALTPHLPTHADSQTPST
GTDTQTPSGSAANTTLSPTPRSNDISDVPGERSTASTFPTDPISPLATTLIPARNSSAAL
PARTSNTTITANTSVSYLNASETTTPSPSGSTVISTPTIATTTSKPTCAEKYATIPVDYL
YNNKTKLFTAKLNVNENVECTNNNHTHNICTNNEVLNLPECKEMNVFVSHNSCTDRHKEL
KLDVPPEVEKFQLDDCTPDVEANTTICLKWKIIETFACDKSKITYRFQCGNKTYNKEGIY
LENLEPEYEYKCDSEILYNNHKYINITKLIKTDFGIPGQPQNVVCRHEDAHQGVITWNPP
QRSFHNFTLCYVNKPAKKCLILDKHLTTYHLQNLKPYTNYSLSLHAYIIAKVQRNGTAAT
CNFTTESAPPSQVQNMIVSTSDNSMHVKCEVPRDVNGPTGLYHLEVEAGNTLVRNLSQSK
CDFSVNNLQYSTYYNLKAYYHNGKYSGEPVILRESTSYNSKALIAFLAFLIIVTSIALLV
VLYKIYDLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAE
FQSIPRVFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGF
KEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAF
GDIVVKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRR
RVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMV
QVEAQYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRS
WRTQHIGNQEENKNKNRNSNVIPYDYNRVPLKHELEMSKESDHDSDESSDDDSDSEEPSK
YINASFIMSYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYW
GEGKQTYGDIEVDMKDTNKSSTYTLRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKE
LVSLIQVLKEKLPQKNFSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVD
IFQVVKALRKARPGMVSTFEQYQFLYDIIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK
QDANCVNPLGATEKLPEAKEQATGSEPTSGTEGPEHSVNGPASPALNQGS
NT seq 3933 nt   +upstreamnt  +downstreamnt
atgaccatgtgtttgtggcttaaacttttggcatttgtctttgcctttctggacacagaa
gtatttgtgacagggcaaggctcaacactttcccccactggacggagaacgacaaagatg
cccagtgttccactttcaagtgaccccttacctactcacaccactgcattctcacctgca
agcatctctgaaagagaaaatgacttctcagagaccacaccatctcttagttcagacaat
acttcaacccaagtatccccggactctttggataacgctagtgcttttaatacgacaggt
gtttcatcagcactgacgcctcaccttcccacgcatgcagactcgcagacgccctctact
ggaactgacacgcagacacccagcggctccgccgccaataccacactcagccctacccca
cgcagcaatgatatctcagatgtcccaggagagaggagtacagccagcacctttcctaca
gacccaatttccccattagcaaccaccctcatccctgcacgcaacagctctgctgcctta
cctgcacgcacctccaacaccaccatcacagcgaacacctcagtttcctaccttaatgcc
tctgaaacaaccactccgagcccttctggaagcactgtcatttcaaccccaacaatagct
actactacatctaagccaacatgtgctgaaaaatatgcaaccatccctgtggattactta
tataacaacaaaactaaattatttacagcaaagctaaatgttaatgagaatgtggaatgt
acaaacaataatcacacacacaatatttgcacaaacaatgaggtgcttaatcttccagaa
tgtaaagaaatgaatgttttcgtatctcataattcatgtacagatcgtcataaagaatta
aaattagatgtgccaccagaggttgaaaagtttcagttagatgattgtacaccggatgta
gaagcaaataccactatttgtttaaaatggaaaattattgaaacctttgcttgtgataaa
agtaaaattacctacagatttcaatgtggtaataaaacatataataaggaaggcatttat
ttagaaaaccttgaacctgaatatgagtataagtgtgactcagaaatactctataataac
cacaagtatattaacataaccaaacttataaaaacagattttgggattccaggacagcct
cagaatgttgtttgtagacatgaagatgcacatcaaggagtaattacttggaatccccct
caaagatcatttcataattttactctctgttatgtaaacaagccagcaaaaaaatgcctc
attctggataaacacctgacaacatatcatttgcaaaatttgaaaccttatacaaactat
agtttatcattacatgcctacatcattgcaaaagtgcaacgtaatggaactgctgcaaca
tgtaatttcacaactgaaagtgcacctccaagccaggtccagaacatgattgtctccaca
tcagataatagtatgcatgtcaagtgtgaggttcccagggacgttaatggccccactgga
ctttaccatctggaagtcgaagctggaaatactctagttagaaatctgtcacaatctaag
tgcgatttctctgtaaacaatcttcaatattcaacatactacaatcttaaggcctattat
cacaatggaaaatattctggagaaccagttattttacgtgaatcaacatcttataattct
aaggcactgatagcatttctggcatttctgattattgtgacatcaatagccctacttgtt
gttctctataaaatctatgatctacataagaaaagatcctgcaatttggatgaacaacag
gagcttgttgaaagggatgatgaaaaacaactgatgaatgtggagccaatccatgcagat
attttgttggaaacttataagaggaagattgctgatgaaggaagactttttctggctgaa
tttcagagcatcccgcgggtgttcagcaagtttcctataaaggaagctcgaaagcccttt
aaccagaataaaaaccgttatgttgacattcttccttatgattataaccgtgttgaactc
tctgagataaatggagatgcagggtcaaactacataaatgccagctatattgatggtttc
aaagaacccaggaaatacattgctgcacaaggtcccagggatgaaaccgttgatgatttc
tggaggatgatttgggaacagaaagccacagttattgtcatggtcactcgatgtgaagaa
ggaaacaggaacaagtgtgcagaatactggccgtcaatggaagagggcactcgggctttt
ggagatattgttgtaaagatcaaccagcacaaaagatgtccagattacatcattcagaaa
ttgaacattgtaaataaaaaagaaaaagcaactggaagagaggtgactcacattcagttt
accagctggccagaccacggggtgcctgaggatcctcacttgctcctcaaactgagaagg
agagtgaatgccttcagcaatttcttcagtggtcccattgtggtgcactgcagtgctggt
gtcgggcgcacaggcacctatattggaattgatgccatgctagaaggcctggaagctgag
aacaaagtagatgtttatggttacgttgtcaagctaaggcgacagagatgcctgatggtt
caagtagaggcccagtacatcttgatccatcaggctttggttgaatacaatcagtttgga
gaaacagaagtgaatttgtctgaattacatccatatctacataacatgaagaaaagggat
ccacccagtgagccatctccactagaggctgaattccagagacttccttcatataggagc
tggaggacacagcacattggaaatcaggaagaaaataaaaataaaaacaggaattctaat
gtcatcccatatgactataacagagtgccacttaaacatgagctggaaatgagtaaagag
agtgaccatgattcagatgaatcctctgatgatgacagtgattcagaggaaccaagcaaa
tacatcaatgcatcttttataatgagctactggaaacctgaagtgatgattgctgctcag
ggaccactgaaggagaccattggtgacttttggcagatgatcttccaaagaaaagtcaaa
gttattgttatgctgacagaactgaaacacggagaccaggaaatctgtgctcagtactgg
ggagaaggaaagcaaacatatggagatatcgaagttgacatgaaagacacaaacaaatct
tcaacttacacccttcgtgtctttgaactgagacattccaagaggaaagactctcgaact
gtgtaccagtaccaatatacaaactggagtgtggagcagcttcctgcagaacccaaggaa
ttagtctctctgattcaggtcctcaaagaaaaacttccccagaagaatttctccgaaggg
aacaagcatcacaagagtacacctctcctcattcactgcagggatggatctcagcaaacg
ggaatattttgtgctttgttaaatctcttagaaagtgcggaaacagaagaggtagtggat
atttttcaagtggtaaaagctctacgcaaagctaggcctggcatggtttccacatttgag
caataccaattcctatatgacatcattgccagcacctaccctgctcagaatggacaagta
aagaaaaacaaccatcaagaagataaaattgaatttgataatgaagtggacaaagtaaag
caggatgctaattgtgttaatccacttggtgccacagaaaagctccctgaagcaaaggaa
caggctacaggttctgaacccacaagtggcactgaggggccagaacattctgtcaatggt
cctgcaagtccagctttaaatcaaggttcatag

DBGET integrated database retrieval system