KEGG   Macaca fascicularis (crab-eating macaque): 102116472
Entry
102116472         CDS       T02918                                 

Gene name
TNFRSF13C
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04064  NF-kappa B signaling pathway
mcf04672  Intestinal immune network for IgA production
mcf05166  Human T-cell leukemia virus 1 infection
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102116472 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102116472 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102116472 (TNFRSF13C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102116472 (TNFRSF13C)
  09163 Immune disease
   05340 Primary immunodeficiency
    102116472 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102116472 (TNFRSF13C)
   04090 CD molecules [BR:mcf04090]
    102116472 (TNFRSF13C)
Cytokine receptors [BR:mcf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102116472 (TNFRSF13C)
CD molecules [BR:mcf04090]
 Proteins
  102116472 (TNFRSF13C)
SSDB
Motif
Pfam: BaffR-Tall_bind SIT DUF4381 SKG6 DUF4079 G6B DUF6232 Herpes_gE
Other DBs
NCBI-GeneID: 102116472
NCBI-ProteinID: XP_005567184
UniProt: A0A2K5V1K1
Position
10
AA seq 184 aa
MKRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAPASSPAPRTALQPQ
ESVGAGAGEAALSLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD
KDKDEPLDKVIILSPGISDAAAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG
PEQQ
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaagcgagggccccggagcctgcggggcagggacgcgccagcccccacgccctgcgtc
ccggccgagtgcttcgacctgctggtccggcactgcgtggcctgcggactcctgcgcacg
ccgcggccgaaaccggccccggccagcagccctgcgcccaggacggcgctgcagccgcaa
gagtcggtgggcgcgggggccggcgaggcggcgctgtccctacccgggctgctcttcggc
gcccccgcgctgctgggcctggcactggtcctggcgctggtcctggtgggcctggtgagc
tggaggcggcgacagcggcggcttcgcggcgcgtcctccgcagaggcccccgacggagac
aaggacaaggacgaacccctggacaaggtcatcattctgtctccgggaatctctgatgcc
gcagctcctgcctggcctcctcctggggaagacccaggaaccaccccacctggccacagt
gtccctgtgccagccacagagctgggctccactgaactggtgaccaccaagacggccggc
cctgagcaacaatag

DBGET integrated database retrieval system