KEGG   Macaca fascicularis (crab-eating macaque): 102116512
Entry
102116512         CDS       T02918                                 

Gene name
ICOS
Definition
(RefSeq) inducible T-cell costimulator
  KO
K06713  inducible T-cell co-stimulator
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04514  Cell adhesion molecules
mcf04660  T cell receptor signaling pathway
mcf04672  Intestinal immune network for IgA production
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102116512 (ICOS)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102116512 (ICOS)
   04672 Intestinal immune network for IgA production
    102116512 (ICOS)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102116512 (ICOS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102116512 (ICOS)
CD molecules [BR:mcf04090]
 Proteins
  102116512 (ICOS)
SSDB
Motif
Pfam: V-set_2 V-set
Other DBs
NCBI-GeneID: 102116512
NCBI-ProteinID: XP_005574075
UniProt: A0A2K5TQU4
Position
12
AA seq 199 aa
MKSGLWYFFLFCLHMKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQ
ILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLSIFDPPPFK
VTLTGGYLHIYESQLCCQLKFWLPIGCATFVVVCIFGCILICWLTKKKYSSTVHDPNGEY
MFMRAVNTAKKSRLTDVTV
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaagtcaggcctctggtatttctttctcttctgcttgcacatgaaagttttaacagga
gaaatcaatggttctgccaattatgagatgtttatatttcacaacggaggtgtacaaatt
ttatgcaaatatcctgacattgtccagcaatttaaaatgcagttgctgaaaggggggcaa
atactctgcgatctcactaagacaaaaggaagtggaaacacagtgtccattaagagtctg
aaattctgccattctcagttatccaacaacagtgtctctttttttctatataacttggac
cgttctcatgccaactattacttctgcaacctatcaatttttgatcctcctccttttaaa
gtaactcttacaggaggatatttgcatatttatgaatcacaactttgttgccaactgaag
ttctggttacccataggatgtgcaacctttgttgttgtctgcatttttggatgcatactt
atttgttggcttacaaaaaagaagtattcatccaccgtgcacgaccctaacggtgaatac
atgttcatgagagcagtgaacacagccaaaaaatctagactcacagatgtgaccgtataa

DBGET integrated database retrieval system