KEGG   Macaca fascicularis (crab-eating macaque): 102117354Help
Entry
102117354         CDS       T02918                                 

Gene name
PUDP, HDHD1
Definition
(RefSeq) pseudouridine 5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcf01009]
    102117354 (PUDP)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     102117354 (PUDP)
Protein phosphatases and associated proteins [BR:mcf01009]
 HAD phosphatases
  Other HAD phosphatases
   102117354 (PUDP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD
Motif
Other DBs
NCBI-GeneID: 102117354
NCBI-ProteinID: XP_005592974
UniProt: A0A2K5WQD7
Position
X
AA seq 229 aa AA seqDB search
MAAPPPQPVTHLIFDMDGLLLDTERLYSVVFQEICDRYDKKYSWDVKSLVMGKKALEAAQ
IIIDVLQLPMSKEELVEESQTKLKEMFPTAALMPGAEKLIVHLRKHGIPFALATSSGSVS
FEMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDVFLACAKRFSPPPAMEKCLVFEDAPN
GVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPPYE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccccgccgcagcccgtcacccacctcatctttgacatggacggacttctt
ctggatactgaacgactgtattcagtggtgtttcaagaaatatgtgatcgctatgacaag
aaatacagctgggatgtaaagtccctggttatgggtaagaaggcattagaggcggcacag
attataatagacgtcttgcagctcccgatgtccaaagaggagctggtggaagaaagccaa
acgaagttaaaggaaatgttccccacggctgcgctcatgccaggggctgagaaactcatc
gtccacctgcggaaacacggcatcccctttgcgctggccaccagctcagggtccgtgtcg
ttcgagatgaagacgagccgccacaaggaattcttcagcttgttttcccacattgtgctg
ggagatgaccctgaagtgcagcatggcaagccagaccccgacgtcttcctagcttgtgcc
aagagattctctccccctcctgctatggagaagtgccttgtctttgaagatgctcccaat
ggggtggaggcggccctggcagctgggatgcaggtggtcatggttcctgacggaaacttg
agccgagacctgacgacaaaggccaccctggtgctgaattccctgcaggacttccagccc
gagctgtttggtttgcccccatatgagtga

DBGET integrated database retrieval system