KEGG   Macaca fascicularis (crab-eating macaque): 102117446
Entry
102117446         CDS       T02918                                 

Gene name
IGLL5
Definition
(RefSeq) immunoglobulin lambda like polypeptide 5
  KO
K06554  immunoglobulin lambda-like polypeptide 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102117446 (IGLL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102117446 (IGLL5)
CD molecules [BR:mcf04090]
 Proteins
  102117446 (IGLL5)
SSDB
Motif
Pfam: C1-set Ig_3 ig C2-set_2 PTCRA I-set Marek_A
Other DBs
NCBI-GeneID: 102117446
NCBI-ProteinID: XP_015312470
Position
10
AA seq 142 aa
MAPGGCVGKKPTPVREKSQNRGQTAALYEETRTRGTGHPKASPLVTLFPPSSEELQANNA
TLVCLISDFYPGAVEVAWKADGSPVNMGVETTTPSKQSNNKYAASSYLSLTSDQWRSHNS
YSCQVTHEGSTVEKTVGRAECS
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcgccagggggatgtgtggggaagaaacccactcccgtgagagagaagagccagaac
cgaggacaaacagctgccctgtatgaagagacaagaacaaggggaactggtcaccccaag
gcttcccccttggtcactctgtttccgccctcctctgaggagcttcaagccaacaatgcc
acactagtgtgtctgatcagtgacttctacccgggagccgtggaagtggcctggaaggca
gatggcagccccgtcaacatgggagtggagaccaccacaccctccaaacagagcaacaac
aagtacgcggccagcagctacctgagcctgacgtccgaccagtggaggtcccacaacagc
tacagctgccaggtcacgcacgaagggagcaccgtggagaagacagtgggccgtgcagaa
tgctcttag

KEGG   Macaca fascicularis (crab-eating macaque): 102131516
Entry
102131516         CDS       T02918                                 

Gene name
IGLL1
Definition
(RefSeq) immunoglobulin lambda like polypeptide 1
  KO
K06554  immunoglobulin lambda-like polypeptide 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102131516 (IGLL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102131516 (IGLL1)
CD molecules [BR:mcf04090]
 Proteins
  102131516 (IGLL1)
SSDB
Motif
Pfam: C1-set ig Ig_3 C2-set_2 Ig_2 I-set
Other DBs
NCBI-GeneID: 102131516
NCBI-ProteinID: XP_005595404
Position
Un
AA seq 213 aa
MRPGTGQPGREAPGEPGPNLRQRWPLLLLGLALVTHGLVHPTAAPQSRALGPGAPGGSSR
SSLRSRWGRFLLQHGSWTGPRCWPREFQSRHNSLRHVFGSGTQLTVLGQPKATPSVTLFP
PSSEELQANKATLVCLMSDFYPGILTVTWKADGTPITQGMEMTMPSKQSNNKYAASSYLS
LTPEQWRSRRSYSCQVTHEGSTVEKTVTHAQCS
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaggccagggacaggccagccgggccgtgaggcccctggtgagccaggccccaacctc
aggcagcgctggcccctgctgctgctgggtctggcgctggtaacccatggcctggtgcac
ccaacggctgcaccgcagagcagagccctgggccctggagcccctggaggaagcagccgg
tccagcctgaggagccggtggggcaggttcctgctccagcacggctcctggactggcccc
aggtgctggccccgggagtttcagtccaggcataattcactgaggcatgtgtttggcagc
gggacccagctcactgttttaggtcagcccaaggccaccccctcggtcactctgttcccg
ccgtcctctgaggagctccaagccaacaaggccacgctggtgtgtctcatgagtgacttc
tatccgggaatcttgacggtgacctggaaggcagatggtacccccatcacccagggcatg
gagatgaccatgccctccaaacaaagcaacaacaagtacgcggccagcagctacctgagc
ctgactcccgagcagtggaggtcccgcagaagctacagctgccaggtcacgcatgaaggg
agcaccgtggagaagacagtgacccatgcacaatgttcatag

DBGET integrated database retrieval system