KEGG   Macaca fascicularis (crab-eating macaque): 102118696
Entry
102118696         CDS       T02918                                 

Gene name
CD40
Definition
(RefSeq) CD40 molecule
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04064  NF-kappa B signaling pathway
mcf04514  Cell adhesion molecules
mcf04620  Toll-like receptor signaling pathway
mcf04672  Intestinal immune network for IgA production
mcf05144  Malaria
mcf05145  Toxoplasmosis
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05202  Transcriptional misregulation in cancer
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05322  Systemic lupus erythematosus
mcf05330  Allograft rejection
mcf05340  Primary immunodeficiency
mcf05416  Viral myocarditis
mcf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102118696 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102118696 (CD40)
   04514 Cell adhesion molecules
    102118696 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102118696 (CD40)
   04672 Intestinal immune network for IgA production
    102118696 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102118696 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102118696 (CD40)
   05169 Epstein-Barr virus infection
    102118696 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    102118696 (CD40)
   05145 Toxoplasmosis
    102118696 (CD40)
  09163 Immune disease
   05310 Asthma
    102118696 (CD40)
   05322 Systemic lupus erythematosus
    102118696 (CD40)
   05320 Autoimmune thyroid disease
    102118696 (CD40)
   05330 Allograft rejection
    102118696 (CD40)
   05340 Primary immunodeficiency
    102118696 (CD40)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102118696 (CD40)
   05416 Viral myocarditis
    102118696 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102118696 (CD40)
   04090 CD molecules [BR:mcf04090]
    102118696 (CD40)
Cytokine receptors [BR:mcf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102118696 (CD40)
CD molecules [BR:mcf04090]
 Proteins
  102118696 (CD40)
SSDB
Motif
Pfam: TNFR_c6 RANK_CRD_2
Other DBs
NCBI-GeneID: 102118696
NCBI-ProteinID: XP_005569274
Position
10
AA seq 282 aa
MVRLPLQCVLWGCLLTAVYPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCTSESCESCV
PHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTN
KTDVVCGPQDRQRALVVIPICLGILFVILLLVLVFISESSEKVAKKPNDKVPHPKQEPQE
INFPDDLPGSNPAAPVQETLHGCQPVTQEDGKESRISVQERQ
NT seq 849 nt   +upstreamnt  +downstreamnt
atggttcgtctgcctctgcagtgcgtcctctggggctgcttgctgaccgctgtctatcca
gaaccacccactgcatgcagagaaaaacagtacctaataaacagtcagtgctgttctttg
tgccagccaggacagaaactggtgagtgactgcacagagttcaccgaaacagaatgcctt
ccttgcggtgaaagcgaattcctagacacctggaatagagagacacgctgccaccagcac
aaatactgcgaccccaacctagggcttcgggtccagcagaagggcacctcagaaacagac
accatctgcacctgtgaagaaggcctgcactgtacgagtgagtcctgtgagagctgtgtc
ccgcaccgctcatgcttgcctggctttggggtcaagcagattgctacaggggtttctgat
accatctgtgagccctgcccggtcggcttcttctccaatgtgtcatctgcttttgaaaag
tgtcgcccttggacaagctgtgagaccaaagacctggttgtgcaacaggcaggcacaaac
aagactgatgttgtctgtggtccccaggatcggcagagagccctggtggtgatccccatc
tgcttggggatcctgtttgtcatcctcctcttggtgctggtctttatcagtgagtcctca
gaaaaggtggccaagaagccaaacgataaggtcccccaccccaagcaggaaccccaggag
atcaattttccggacgatcttcctggctccaaccctgccgctccagtgcaggagacttta
catggatgccaaccagtcacccaggaggatggcaaagagagtcgcatctcagtgcaggag
agacagtga

DBGET integrated database retrieval system