KEGG   Macaca fascicularis (crab-eating macaque): 102119084Help
Entry
102119084         CDS       T02918                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00561  Glycerolipid metabolism
mcf01100  Metabolic pathways
mcf04714  Thermogenesis
mcf04723  Retrograde endocannabinoid signaling
mcf04923  Regulation of lipolysis in adipocytes
Module
mcf_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102119084 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102119084 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    102119084 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    102119084 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcf01002]
    102119084 (MGLL)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102119084 (MGLL)
Peptidases [BR:mcf01002]
 Serine Peptidases
  Family S33
   102119084 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH PGAP1 Thioesterase Abhydrolase_5 LIDHydrolase DUF1350 Abhydrolase_2 DUF1057 FSH1 DUF2974
Motif
Other DBs
NCBI-GeneID: 102119084
NCBI-ProteinID: XP_005571841
Position
11
AA seq 339 aa AA seqDB search
METGSEDPSRMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYEELAQMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD
YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKDYSGILKYSM
EKASRTLQFWIPNPFWVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAG
LKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMESAKSQDKTLKIY
EGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggatctgaagacccttccagaatgccagaggaaagttcccccaggcggacc
ccgcagagcattccctaccaggatctccctcacttggtcaatgcagatggacagtacctc
ttctgcaggtactggaaacccacaggcacacccaaggccctcatctttgtgtcccatgga
gctggagagcactgtggccgctatgaagagctggctcagatgctgatggggctggacctg
ctggtgttcgcccacgaccatgttggccacggacagagcgaaggggagaggatggtagtg
tctgacttccacgttttcgtcagagatgtgttgcagcatgtggattccatgcagaaagac
taccctgggcttcctgtcttccttctgggccactccatgggaggtgccatcgccatcctc
acggccgcagaaaggccgggccacttcgccggcatggtactcatttcacctctggttctt
gccaatcctgaatctgcaacaactttcaaggattattcggggattttgaaatattcgatg
gaaaaggcatcaagaacgttacagttttggattccaaatcctttttgggtccttgctgca
aaagtgctcaaccttgtgctgccaaacttgtccctcgggcccatcgactccagcgtgctc
tctcggaataagacagaggtcgacatttataactcagaccccttgatctgccgggcaggg
ctgaaggtgtgctttggcatccagctgctgaatgccgtctcacgggtggagcgcgccctc
cccaagctgacggtgcccttcctgctgctccagggctctgccgatcgcctgtgtgacagc
aaaggggcctacctgctcatggagtcagccaagagccaggacaagactctcaagatttat
gaaggtgcctaccacgttctccacaaagagcttcctgaagtcaccaactccgtcttccat
gaaataaacatgtgggtctctcaaaggacagccacggcaggaactgcgtccccaccctga

DBGET integrated database retrieval system