KEGG   Macaca fascicularis (crab-eating macaque): 102120453Help
Entry
102120453         CDS       T02918                                 

Gene name
PPARG, PPARgamma1, PPARgamma2, PPARgamma3, PPARgamma4, PPARgamma5, PPARgamma6, PPARgamma7
Definition
(RefSeq) peroxisome proliferator activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf03320  PPAR signaling pathway
mcf04152  AMPK signaling pathway
mcf04211  Longevity regulating pathway
mcf04380  Osteoclast differentiation
mcf04714  Thermogenesis
mcf05016  Huntington disease
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102120453 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102120453 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102120453 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    102120453 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    102120453 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102120453 (PPARG)
   05202 Transcriptional misregulation in cancer
    102120453 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    102120453 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102120453 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102120453 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcf03310]
    102120453 (PPARG)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    102120453 (PPARG)
Nuclear receptors [BR:mcf03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   102120453 (PPARG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Motif
Other DBs
NCBI-GeneID: 102120453
NCBI-ProteinID: NP_001270028
UniProt: Q95J17
Position
2
AA seq 475 aa AA seqDB search
MVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRTDPMV
ADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT
DKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKS
IPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVFISEGQGFMTREFLKSLRKPFGD
FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggttgacacagagatgccattctggcccaccaactttgggatcagctccgtggatctc
tccgtaatggacgaccactcccactcctttgacatcaagcccttcactactgttgacttc
tccagcatttctgctccacattatgaagacattccattcacaagaacagatccgatggtt
gcggattataagtacgacctgaaacttcaagagtaccaaagtgcaatcaaagtggagcct
gcttctccaccttattattctgagaagactcagctctacaataagcctcacgaagagcct
tccaactccctcatggcaatcgaatgtcgtgtctgcggagataaagcttctggattccac
tatggagttcatgcttgtgaaggatgcaagggtttcttccggagaacaatcagattgaag
cttatctatgacagatgtgatcttaactgtcggatccacaaaaaaagtagaaataaatgt
cagtactgtcggtttcagaaatgccttgcagtggggatgtctcataatgccatcaggttt
gggcggatgccacaagccgagaaggagaagctgttggcggagatctccagtgatatcgac
cagctgaacccagagtccgctgacctccgggccctggcaaaacatttgtatgactcatac
ataaagtccttcccgctgaccaaagcaaaggcgagggcgatcttgacaggaaagacaaca
gacaaatcaccattcgttatctatgacatgaattccttaatgatgggagaagataaaatc
aagttcaaacacatcaccccgctgcaggagcagagcaaagaggtggctatccgcatcttt
cagggctgccagtttcgctccgtggaggctgtgcaggagatcacagagtatgccaaaagc
attcctggtttcgtaaatcttgacttgaacgaccaagtaactctcctcaaatatggagtc
catgagatcatttacacaatgctggcctccttgatgaataaagatggggttttcatatcc
gagggccaaggcttcatgacaagggaatttctaaagagcctgcgaaagccttttggtgac
tttatggagcccaagtttgagtttgctgtgaagttcaatgcactggaattagatgacagc
gacttggcaatatttattgctgtcattattctcagtggagatcgcccaggtttgctgaat
gtgaagcccattgaagacattcaagacaacctgctacaagccctggagctccagctgaag
ctgaaccaccctgagtcctcgcagctgtttgccaagctgctccagaaaatgacagacctc
agacagattgtcacggaacacgtgcagctactgcaggtgatcaagaagacggagacagac
atgagtcttcacccgctcctgcaggagatctacaaggacttgtactag

DBGET integrated database retrieval system