KEGG   Macaca fascicularis (crab-eating macaque): 102120590Help
Entry
102120590         CDS       T02918                                 

Gene name
EIF3C
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102120590 (EIF3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mcf03012]
    102120590 (EIF3C)
Translation factors [BR:mcf03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102120590 (EIF3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 102120590
NCBI-ProteinID: XP_005591624
UniProt: A0A2K5VX05 G7Q0U3
Position
20
AA seq 913 aa AA seqDB search
MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEEL
TNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNEL
WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEG
SSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDS
DSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGE
WERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQI
AAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFV
GENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVC
AIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENE
GEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQH
ADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQ
EQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRV
GERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLV
RKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQ
TVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMR
RGGYRQQPSQTAY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggtttttcaccaccggttcggacagcgagtccgagtcgtccctgtccggggag
gagctcgtcaccaaacctgtcggaggcaactatggcaaacagccattgttgctgagcgag
gatgaagaagataccaagagagttgtccgcagtgccaaggacaagaggtttgaggagctg
accaaccttatccggaccatccgtaatgctatgaagattcgtgatgtcaccaagtgcctg
gaagagtttgagctcctgggaaaagcatatgggaaggccaagagcattgtggacaaagaa
ggtgtcccccggttctatatccgcatcctggctgacctagaggactatcttaatgagctt
tgggaagataaggaagggaagaagaagatgaacaagaacaatgccaaggctctgagcacc
ttgcgccagaagatccgaaaatacaaccgtgattttgagtcccatatcacaagctacaag
cagaaccccgagcagtccgcagatgaagatgctgagaaaaacgaggaagattcagaaggc
tcttcagatgaggatgaggatgaggacggagtcagtgctgcaactttcttgaagaagaaa
tcagaagctccttctggggagagtcgcaaattcctcaaaaagatggatgatgaagatgag
gactcagaagattctgaagatgatgaggactgggacacaggttccacatcttctgattcc
gactcagaggaggaggaagggaaacaaaccgcgctggcctcaagatttcttaaaaaggca
cccaccacagatgaggacaagaaggcagccgagaagaaacgggaggacaaagctaagaag
aagcatgacaggaaatccaagcgcctggatgaggaggaggaggacaatgaaggcggggag
tgggaaagggtccggggtggagtgcccttggttaaggagaagccaaaaatgtttgccaag
ggaaccgagatcacccacgctgttgttatcaagaagttgaatgagatcctacaggcacga
ggaaagaagggaactgatcgtgctgcccagattgagctgctgcaactgctggttcagatc
gcagcagaaaacaacctgggagagggcgtcattgtcaagatcaagttcaatatcattgcc
tctctctatgactacaaccctaacctggcaacctacatgaagccagagatgtgggggaag
tgcctggactgcatcaatgagcttatggacatcctgtttgcaaatcccaacatttttgtt
ggagagaatattctggaagagagtgagaacctgcacaacgctgaccagccactgcgtgtc
cgtggctgcatcctaactctggtagaacgaatggatgaagaatttaccaaaataatgcaa
aatactgaccctcactcccaagagtatgtggagcatttgaaggatgaagcccaggtgtgt
gccatcatcgagcgcgtgcagcgctacctggaggagaagggcactaccgaggaggtctgc
cgcatctacctgctgcgcatcctgcacacctactacaagtttgattacaaggcccatcag
cggcagctgactccgcccgagggctcctcaaagtctgagcaagaccaggcagaaaatgag
ggtgaggactcggccgtgttgatggagagactgtgcaagtacatctacgccaaagaccgc
acagaccggatccgcacatgcgccatcctctgccacatctaccaccatgctctgcactcc
cgctggtaccaggcccgcgacctcatgcttatgagccacctgcaggacaacattcagcac
gcagacccgccagtgcagatcctttacaaccgcaccatggtgcagctgggcatctgtgcc
ttccgccaaggcctgaccaaggacgcacacaatgccctgctggacatccagtcaagtggc
cgagccaaggagcttctgggccagggcctgctgctgcgcagcctgcaggagcgcaaccag
gagcaggagaaggtggagcggcgccggcaggtccccttccacctgcacatcaacctggag
ctgctggagtgtgtctacctggtgtctgccatgctcctggagattccctacatggctgcc
catgagagcgatgcccgccgacgcatgatcagcaagcagttccaccaccagttgcgcgtg
ggcgagcgacagcccctactgggtccccctgagtccatgcgggaacatgtggtcgctgcc
tccaaggccatgaagatgggtgactggaagacctgtcacagttttatcatcaatgagaag
atgaatgggaaagtgtgggaccttttccccgaggctgacaaagtccgcaccatgctggtt
aggaagatccaggaagagtcactgaggacctacctcttcacctacagcagtgtctacgac
tccatcagcatggagaccctgtcagacatgtttgagctggatctgcccactgtgcactcc
atcatcagcaaaatgatcattaatgaggagctgatggcctccctggaccagccaacgcag
acagtggtgatgcaccgcaccgagcccactgcccagcagaacctggccctgcagctggcc
gagaagctgggcagcctggtggagaacaatgagcgagtgtttgaccacaaacaaggcacc
tacgggggctacttccgagaccagaaggacggctaccgcaaaaacgagggctacatgcgc
cgcggtggctaccgccagcagccatctcaaacggcctactga

DBGET integrated database retrieval system