KEGG   Macaca fascicularis (crab-eating macaque): 102121293Help
Entry
102121293         CDS       T02918                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00480  Glutathione metabolism
mcf00590  Arachidonic acid metabolism
mcf01100  Metabolic pathways
mcf04918  Thyroid hormone synthesis
mcf05014  Amyotrophic lateral sclerosis (ALS)
mcf05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102121293 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102121293 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102121293 (GPX2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    102121293 (GPX2)
   05016 Huntington disease
    102121293 (GPX2)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102121293 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 102121293
NCBI-ProteinID: XP_005561547
Position
7
AA seq 190 aa AA seqDB search
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK
DKLPYPHDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctttcattgccaagtccttctatgacctcagtgccatcagcctggatggggagaag
gtagatttcaatacgttccggggcagggccgtgctgattgaaaatgtggcttcactctga
ggcacaaccactcgggacttcacccagctcaacgagctgcaatgccgctttcccaggcgc
ctggtggtccttggcttcccttgcaaccaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagtctcaagtatgtccgtcctgggggtggataccagcctactttcacc
cttgtccaaaaatgtgaggtgaatgggcagaatgagcatcctgtcttcgcctacctgaag
gacaagctcccctaccctcatgatgacccattttccctcatgaccgatcccaagctcatc
atttggagccccgtgcgccgttcagatgtggcctggaactttgagaagttcctcataggg
ccggagggagagcccttccgacgctacagccgcaccttcccaaccatcaacattgagcct
gacatcaagcgcctccttaaagttgccatatag

DBGET integrated database retrieval system