KEGG   Macaca fascicularis (crab-eating macaque): 102121561Help
Entry
102121561         CDS       T02918                                 

Gene name
NAT2
Definition
(RefSeq) arylamine N-acetyltransferase 2
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00232  Caffeine metabolism
mcf00983  Drug metabolism - other enzymes
mcf01100  Metabolic pathways
mcf05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    102121561 (NAT2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102121561 (NAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102121561 (NAT2)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     102121561 (NAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 102121561
NCBI-ProteinID: XP_005562758
Position
8
AA seq 290 aa AA seqDB search
MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGEAMELGLETIFDHIV
RRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYVYIPAANKYSTGMIHLLLQVTIDGRNYI
ADAGFGSSSQMWQPLELISGKDQPQMPSIFRLTEQKGIWYLDQIRREQYIPNTEFLNSDL
LPKTTHQKVYSFTLEPRKIEDFESMNTYLQTSPTSAFTTTSFCSLQTPEGVHCLVGFTLT
YRIFNYKDNTDLIEFKTLIEEEVEEVLKNIFKISLGRKLVPKPGNGSFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatattttgaaagaattggctataagaactctaggaacaagctggac
ttggaaacattaactgacattcttgagcaccagatccgagctgttccctttgagaacctt
aacatgcattgtggggaagctatggagttgggcttagagactatttttgatcacattgta
agaagaaaccggggtgggtggtgtctccaggtcaatcaacttctgtactgggctctgacc
acaatcggttttcagaccacaatgttaggagggtatgtttacatccctgcagctaacaaa
tacagcactggcatgattcaccttctcctgcaggtaaccattgatggcaggaactacatt
gctgatgctggctttggaagctcctcccagatgtggcagcctctggaattaatttctggg
aaggatcagcctcagatgccttccattttccgcttgacagaacagaaaggaatctggtac
ctggaccaaatcagaagagagcagtatattccaaacacagaatttcttaattctgatctc
ctgccaaagacgacacaccaaaaagtgtactcttttacgcttgaacctcgaaaaattgaa
gattttgagtctatgaatacatacctgcaaacgtctccaacatctgcatttacaaccaca
tcattttgttccttgcagaccccagaaggggttcactgtttggtgggcttcaccctcacc
tatagaatattcaattataaagacaatacagatctgatcgagtttaaaactctgattgag
gaagaagttgaagaagtgctgaaaaatatatttaagatttccttggggagaaagctcgtg
cccaaacctggtaatggatccttcactatttag

DBGET integrated database retrieval system