KEGG   Macaca fascicularis (crab-eating macaque): 102123412
Entry
102123412         CDS       T02918                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcf03021]
    102123412 (AFF3)
Transcription machinery [BR:mcf03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102123412 (AFF3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 102123412
NCBI-ProteinID: XP_015288752
Position
13
AA seq 1147 aa
MKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQTQPSSIGSTTTSTPAAVPV
QQTKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQER
PPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSPSETS
VHCTSYRGVPASKPEPARAKAKLSKFSIPKQVEESRSGETNSCVEEIIREMTWLPPLSAI
QAPGKVEPTKFPFPNKDSQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEE
NEQAAQRTALRTLSDSTVVQQPNCRTSVPSSKGSSSSSSSGSSSSSSDSESSSGSDSETE
SSSSESEGSKPPHFSSPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPESNQYYNP
VKEDVQDCGKVPDVCQPSLREKEVKSTCKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVS
AAAPPPAVPCAPAENAPAPARRSAGKKPTRRAERTSAGDGANLHRPEEPAAPDALGASVV
VPPEPTKTRPCGNNRASHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDS
DLESEQEEYPLSKAQTVAASASSGNDQRLKEAAANGGSGPRAPVGSINARTTSDIAKELE
EQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLSAPATKDSES
ALPSHTSDTPAEKALPKSKRKRKCDNEDDYREIKKAQGEKDSSSRLATSTGNTLSANHCN
MNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSSRPNGNSLFTSASSSKKPKA
DSQLQPHGGDLTKAAHNNSENIPLHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADY
FMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELI
RYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSK
AAQAPSPWGASGKSTGTPSPMSPNPSPASSVGSQGSLSNASALSPSTIVSIPQRIHQMAA
NHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWL
RNSAHLS
NT seq 3444 nt   +upstreamnt  +downstreamnt
atgaaagactttttaactgatagatccaatcagagtcatctcgtcggagttcccaaacct
ggggttcctcagactcctgtgaacaagatcgatgaacattttgttgcagattcaagagcc
cagacccagccctcatctatcggtagcactacaacttccacaccagcagctgtccccgtg
cagcagactaagagaggcactatgggctggcagaaggctgggcacccaccctccgacggc
caacagagagcaacacaacagggctctctcaggaccttgcttggagatggtgttggcaga
cagcagccacgggccaaacaagtatgcaatgtggaggtgggccttcagacccaggagaga
ccacctgccatggcggccaagcacagcagcagcggacactgtgttcagaactttcctcca
tccctagcttcaaaacccagcctggtccagcagaaaccgaccgcgtacgtgcggccgatg
gacggccaagatcaggcccctgatgagtctcctaagctgaagtcgccttcggaaaccagc
gtgcactgcacatcgtacagaggagtccccgccagcaagccggagccggccagagccaag
gccaagctctccaagttcagcatccccaagcaggtggaggagagtagatctggagaaacc
aacagctgtgttgaagaaataatccgggagatgacctggcttccaccactttctgctatt
caagcacctggcaaagtggaaccaaccaaatttccatttccaaataaggactctcagctt
gtatcctctggacacaataatccaaagaaaggtgatgcagagccagagagtccagacaat
ggcacatcgaatacatcaatgctggaagatgaccttaagctaagcagtgatgaagaggag
aatgaacaggcagctcagagaacagctctccgcactctgtctgacagcaccgtggtccag
cagcccaactgcagaacctcagtgccttccagcaagggcagcagcagcagcagcagcagc
ggcagcagcagctcctccagcgactcagagagcagctcaggatctgactcggagaccgag
agcagctccagcgagagtgagggcagcaagcccccccacttctccagccctgaggctgaa
ccggcatcctctaacaagtggcagctggataaatggctgaacaaagttaatccccacaag
cctcctattctgatccaaaacgaaagccacgggccagagagcaatcagtactacaacccg
gtgaaagaggacgtccaggactgtgggaaagtccccgacgtctgccagcccagcctgagg
gagaaggaggtcaagagcacctgcaaggaggagcagaggccgaggacagccaacaaggcc
cctgggagtaaaggcgtgaagcagaagtccccgcccgcggccgtggccgtggctgtgagc
gcagccgccccgccgcccgcagtgccctgtgcgcccgcggagaacgcacctgcgcccgcc
cggaggtcggcgggcaagaagcccaccaggcgcgcggagaggacctcagccggggacggc
gccaacctccaccggcccgaggagcccgcggccccggacgcactgggcgcaagcgtggtg
gtccccccggagcccaccaaaaccaggccctgtggcaacaacagagcgagccaccgcaag
gagctgcgctcctccgtgacctgcgagaagcgccgcacgcgggggctgagcaggatcgtc
cccaaatccaaggagttcattgagacagagtcgtcatcgtcgtcctcctcctcggactcc
gacctggagtccgagcaggaggagtaccctctgtccaaagcacagaccgtggctgcctct
gcctcctccgggaatgatcagaggctgaaggaggccgctgccaacgggggcagtggtccc
agggcccctgtaggctccatcaacgccaggaccaccagtgacatcgccaaggagctggag
gagcagttctacaccctggtcccctttggccggaacgaacttctgtcccctctaaaggac
agtgatgaggtcaggtctctctgggtcaaaatcgacctgaccctcctgtccaggatccca
gagcacctgccgcaggaaccaggggtcttgagcgcccctgccaccaaggactctgagagc
gcactgcccagccacacctcagacacacctgcagaaaaggctttgccaaaatccaagagg
aaacgcaagtgtgacaacgaagacgactacagggagatcaagaaggcccagggagagaaa
gacagctcttcaagactggccacctccaccggtaatactttgtctgcaaaccactgcaac
atgaacatcaacagtgtggcaataccaataaataaaaatgaaaaaatgcttcggtcgccc
atctcacccctctccgatgcatctaaacacaaatacaccagcgaggacttaacttcttcc
agccgacctaatggcaacagtttgttcacttcagcctcttccagcaaaaagcctaaggcc
gacagccagctgcagcctcacggcggagacctcacgaaagcagctcacaacaattctgaa
aacattcccctccacaagtcacgaccgcagacggagccgtggtctccaggctccaacggc
cacagggactgcaagaggcagaaactcatcttcgatgatatgcctcgcagtgccgattat
tttatgcaagaagctaaacgaatgaagcataaagcagatgcaatggtggaaaagtttgga
aaggctttgaactatgctgaagcggcgttgtcgtttattgagtgtggaaatgcaatggaa
caaggccccatggaatccaaatctccttatacgatgtattcagaaacagtagagctcatc
aggtatgccatgagactaaaaacccactcaggccccaacgccacaccagaagacaaacaa
ctggctgcattatgttaccgatgcctggctctcctgtactggcggatgtttcgactcaaa
agggaccacgctgtaaagtattcaaaagcactaattgactatttcaagaactcatctaaa
gccgcccaagccccatccccgtggggggccagtggaaagagcactggaaccccatccccc
atgtctcccaacccctctcccgccagctcagtggggtctcagggcagcctctccaacgcc
agcgccctgtccccgtcgaccatcgtcagcatcccacagcgcatccaccagatggcggcc
aaccacgtcagcatcaccaacagcatcctgcacagctacgactactgggagatggccgac
aacctggccaaggaaaaccgagaattcttcaatgacctggatctgctcatggggccggtc
accctgcacagcagcatggagcacctggtccagtactcccaacagggcctgcactggctg
cggaacagcgcccacctgtcatag

DBGET integrated database retrieval system