KEGG   Macaca fascicularis (crab-eating macaque): 102123534
Entry
102123534         CDS       T02918                                 

Gene name
BTK
Definition
(RefSeq) Bruton tyrosine kinase
  KO
K07370  Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04064  NF-kappa B signaling pathway
mcf04380  Osteoclast differentiation
mcf04611  Platelet activation
mcf04662  B cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf05169  Epstein-Barr virus infection
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102123534 (BTK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102123534 (BTK)
   04662 B cell receptor signaling pathway
    102123534 (BTK)
   04664 Fc epsilon RI signaling pathway
    102123534 (BTK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102123534 (BTK)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102123534 (BTK)
  09163 Immune disease
   05340 Primary immunodeficiency
    102123534 (BTK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102123534 (BTK)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102123534 (BTK)
Protein kinases [BR:mcf01001]
 Non-receptor tyrosine kinases
  TEC family
   102123534 (BTK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_2 Kinase-like SH3_3 SH3_10 ABC1 Pkinase_fungal Kdo APH Haspin_kinase SH3_4 DNApol3-delta_C
Other DBs
NCBI-GeneID: 102123534
NCBI-ProteinID: XP_005594200
UniProt: G7Q392 A0A2K5VDZ2
Position
X
AA seq 659 aa
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggctgcagtgattctggagagcatctttctgaagcgatcccaacagaaaaagaaaaca
tcacctctaaacttcaagaagcgcctgtttctcttgaccgtgcacaaactctcctactat
gagtatgactttgaacgtgggagaagaggcagtaagaagggttcaatagacgttgagaag
atcacttgcgttgaaacagtggttcctgaaaaaaatcctcctcctgaaagacagattccg
agaagaggtgaagagtccagtgaaatggagcaaatttcaatcattgaaagattcccttat
cccttccaggttgtatatgatgaagggcctctctacgtcttctccccaactgaagaacta
aggaagcggtggattcaccagctcaaaaacgtaatccggtacaacagtgatctggttcag
aaataccacccttgcttctggatcgatgggcagtatctctgctgctctcagacagccaaa
aatgctatgggctgccaaattttggaaaacaggaatggaagcttaaaacctgggagttct
caccggaagacaaaaaagcctcttcccccaacgcctgaggaggaccagatcttgaaaaag
ccactaccgcctgagccagcagcagcaccagtctccacgagtgagctgaaaaaggttgtg
gccctttacgattatatgccaatgaatgcaaatgacctacagctgcggaagggcgacgaa
tattttatcttggaggaaagcaacttaccatggtggcgagcacgagataaaaatgggcaa
gaaggctatattcctagtaactacgtcactgaagcagaagactccatagaaatgtatgag
tggtattccaaacacatgactcggagtcaggctgagcaactgctaaagcaagaggggaaa
gaaggaggtttcattgtcagagactccagcaaagctggcaaatatacagtgtctgtgttt
gctaaatccacaggggaccctcaaggggtgatacgtcattatgttgtgtgttccacacct
caaagccagtattacctggctgagaagcaccttttcagcaccatccctgagctcattaac
taccatcagcacaactctgcgggactcatatccaggctcaaatatccagtgtctcaacaa
aacaagaatgcaccttccacggcaggcctgggatatggatcatgggaaattgatccaaag
gacctgaccttcttgaaggagctggggactggacaatttggggtagtgaagtatgggaaa
tggagaggccagtatgatgtggccatcaagatgatcaaagaaggctccatgtctgaagat
gaattcattgaagaagccaaagtcatgatgaatctttcccatgagaagctggtgcagttg
tatggtgtctgcaccaagcagcgccccatcttcatcatcacggaatacatggccaatggc
tgcctcctgaactacctgagggagatgcgccaccgcttccagactcagcagctgctggag
atgtgcaaggatgtctgtgaagccatggaatacctggagtcaaagcagttccttcaccga
gacctggcagctcgaaactgtttggtaaacgatcaaggagttgttaaagtatctgatttc
ggcctgtccaggtatgtcctggatgatgaatacaccagctcagtaggctccaaatttcca
gtccggtggtccccaccggaagtcctgatgtatagcaagttcagcagcaaatctgacatt
tgggcttttggagttttgatgtgggaaatttactccctggggaagatgccatatgagaga
tttactaacagtgagactgctgaacacattgcccaaggcctacgtctctacaggcctcat
ctggcttcagagaaggtatataccatcatgtacagttgttggcatgagaaagcagatgaa
cgtcccactttcaaaattcttctgagcaatattctagatgtcatggatgaagaatcctga

DBGET integrated database retrieval system