KEGG   Macaca fascicularis (crab-eating macaque): 102123837
Entry
102123837         CDS       T02918                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00230  Purine metabolism
mcf01100  Metabolic pathways
mcf01522  Endocrine resistance
mcf04015  Rap1 signaling pathway
mcf04020  Calcium signaling pathway
mcf04022  cGMP-PKG signaling pathway
mcf04024  cAMP signaling pathway
mcf04062  Chemokine signaling pathway
mcf04072  Phospholipase D signaling pathway
mcf04114  Oocyte meiosis
mcf04211  Longevity regulating pathway
mcf04213  Longevity regulating pathway - multiple species
mcf04261  Adrenergic signaling in cardiomyocytes
mcf04270  Vascular smooth muscle contraction
mcf04371  Apelin signaling pathway
mcf04540  Gap junction
mcf04611  Platelet activation
mcf04713  Circadian entrainment
mcf04714  Thermogenesis
mcf04723  Retrograde endocannabinoid signaling
mcf04724  Glutamatergic synapse
mcf04725  Cholinergic synapse
mcf04727  GABAergic synapse
mcf04742  Taste transduction
mcf04750  Inflammatory mediator regulation of TRP channels
mcf04911  Insulin secretion
mcf04912  GnRH signaling pathway
mcf04913  Ovarian steroidogenesis
mcf04914  Progesterone-mediated oocyte maturation
mcf04915  Estrogen signaling pathway
mcf04916  Melanogenesis
mcf04918  Thyroid hormone synthesis
mcf04921  Oxytocin signaling pathway
mcf04923  Regulation of lipolysis in adipocytes
mcf04925  Aldosterone synthesis and secretion
mcf04926  Relaxin signaling pathway
mcf04927  Cortisol synthesis and secretion
mcf04928  Parathyroid hormone synthesis, secretion and action
mcf04934  Cushing syndrome
mcf04935  Growth hormone synthesis, secretion and action
mcf04970  Salivary secretion
mcf04971  Gastric acid secretion
mcf04972  Pancreatic secretion
mcf04976  Bile secretion
mcf05032  Morphine addiction
mcf05163  Human cytomegalovirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05200  Pathways in cancer
mcf05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102123837 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102123837 (ADCY4)
   04371 Apelin signaling pathway
    102123837 (ADCY4)
   04020 Calcium signaling pathway
    102123837 (ADCY4)
   04072 Phospholipase D signaling pathway
    102123837 (ADCY4)
   04024 cAMP signaling pathway
    102123837 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102123837 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102123837 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102123837 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102123837 (ADCY4)
   04062 Chemokine signaling pathway
    102123837 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102123837 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102123837 (ADCY4)
   04912 GnRH signaling pathway
    102123837 (ADCY4)
   04913 Ovarian steroidogenesis
    102123837 (ADCY4)
   04915 Estrogen signaling pathway
    102123837 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102123837 (ADCY4)
   04921 Oxytocin signaling pathway
    102123837 (ADCY4)
   04926 Relaxin signaling pathway
    102123837 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102123837 (ADCY4)
   04918 Thyroid hormone synthesis
    102123837 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102123837 (ADCY4)
   04916 Melanogenesis
    102123837 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102123837 (ADCY4)
   04927 Cortisol synthesis and secretion
    102123837 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102123837 (ADCY4)
   04270 Vascular smooth muscle contraction
    102123837 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102123837 (ADCY4)
   04971 Gastric acid secretion
    102123837 (ADCY4)
   04972 Pancreatic secretion
    102123837 (ADCY4)
   04976 Bile secretion
    102123837 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102123837 (ADCY4)
   04727 GABAergic synapse
    102123837 (ADCY4)
   04725 Cholinergic synapse
    102123837 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102123837 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102123837 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102123837 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102123837 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102123837 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102123837 (ADCY4)
   04714 Thermogenesis
    102123837 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102123837 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102123837 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102123837 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102123837 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102123837 (ADCY4)
   05163 Human cytomegalovirus infection
    102123837 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102123837 (ADCY4)
Enzymes [BR:mcf01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102123837 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 102123837
NCBI-ProteinID: XP_005561036
UniProt: A0A2K5X5W7 G7P9Z3
Position
7
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLVVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTVYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVDSPVSTSTPLQEKTLASFSPQWSLDRSRTLRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLLLFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFAMAITSLFFFPASSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLIVRLYLGPLDS
RPGVLKEPKFMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRSGPPSVTLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccaccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcg
ctcgcggcgctgctcgtggttgcctgggccagcggcagggagctgacctcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgcgagcagcgactgcagcgctggacgcgtcctctgtccggcttggtatgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggtgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctactggtcctggggctgtatctt
gggccacagccggactcacggcctgcactgctgccgcagttggcagcaaatgcggtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccttgcactcgcgccggcggctggacactgaaaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaaa
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagagagcaccaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacattgtg
ggcttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctccggactgccactctcactgccagaccatgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagtgtactctgtggagtcatcggg
ctgcagaagtggcagtatgacgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcagga
gcttatgctgtggaggacgcaggcatggagcatcgggatccctaccttcgggagctaggg
gagcccacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctctcctcgcttgagggccccaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggtgcagccaagccttttgcccacctgagccacgtagacagccct
gtgtccacctccacccctctccaggagaagaccctggcttccttcagcccccagtggagc
ctagatcggagccgtaccctccgtggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcacagaaacagtggaagcagtcgaaggacttc
aacccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggccatcacgtatagcatcaccttc
ctcctcttcctcctcctcctttttgtctgcttctcagaggacctgatgaggtgcgtcctg
aaaggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcaccgccaccatcctccttgtctttgccatggccattacc
agcctgttcttcttcccagcatcatcagactgccctttccaagctcccaatgtgtcctcc
atgatttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcacgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcagcatcctgctccctcttcctgcac
tcccacgcctggctgtccgactgcctcatcgtccgcctctatctgggccccttggactcc
aggcccggagtgctgaaggagcccaaattcatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctacgaatgcgtttgtgtcctcttcgcttcagtccca
gacttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgaaataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaagaccattggcagcacctacatggcagccacaggattaaatgccacc
tctggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtg
gaatttgccgttgccctgggatctaagctggacgtcatcaacaagcattcattcaacaac
ttccgcctgcgtgtggggttgaaccacggaccagtagtagctggagttattggggcccag
aagccacaatatgacatttggggcaacacagtgaatgtggccagccgcatggagagtaca
ggagtccttggcaaaatccaagtgactgaggagacagcctgggccctacagtccctgggc
tacacctgctacagccggggggtcatcaaggtgaaaggcaaagggcagctctgcacctac
ttcctgaacacagacttgacacgaagtggacctccttcagttaccctaggctga

DBGET integrated database retrieval system