KEGG   Macaca fascicularis (crab-eating macaque): 102123895
Entry
102123895         CDS       T02918                                 

Gene name
CD79A
Definition
(RefSeq) CD79a molecule
  KO
K06506  CD79A antigen
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04662  B cell receptor signaling pathway
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    102123895 (CD79A)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102123895 (CD79A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102123895 (CD79A)
CD molecules [BR:mcf04090]
 Proteins
  102123895 (CD79A)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Adeno_E3_CR1 Ig_2
Other DBs
NCBI-GeneID: 102123895
NCBI-ProteinID: XP_005589476
UniProt: A0A2K5U9J5
Position
19
AA seq 180 aa
MPGGPGVLQALPATIFLFFLLSAAYLGPGCQALWVDGGPTSLMVSLGEEAHFQCLHNGSN
ANVTWWRVLHGNYTWPPQFVGKGQGYNGTLTIQNVNKSHGGIYLCRVQEGNKPHQQSCGT
YLRVRHPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRVSLLRPPSQPGEGLD
NT seq 543 nt   +upstreamnt  +downstreamnt
atgcctgggggtccaggagtcctccaagctctgcctgccaccatcttcctcttcttcctg
ctgtctgctgcctacctgggtcctgggtgccaggccctgtgggtagatgggggcccaaca
tcattgatggtgagcctgggggaagaggcccacttccaatgcctgcacaatggcagcaac
gccaacgtcacctggtggcgcgtcctccatggcaactacacgtggccccctcagttcgtg
ggcaagggccagggctacaatggtacgctgaccatccagaacgtgaacaagagccacggg
ggcatatacctgtgccgggtccaggagggcaataagccacaccagcagtcctgcggcacc
tacctccgtgtgcgccatccgccccccaggcccttcctggacatgggggagggcaccaag
aaccgaatcatcacagccgagggcatcatcctcctgttctgcgcggtggtgcctgggacg
ctgctgctgttcagggtgagcctcctcagacccccgagtcaaccgggcgagggcctggac
tga

DBGET integrated database retrieval system