KEGG   Macaca fascicularis (crab-eating macaque): 102123902Help
Entry
102123902         CDS       T02918                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04068  FoxO signaling pathway
mcf04146  Peroxisome
mcf04211  Longevity regulating pathway
mcf04213  Longevity regulating pathway - multiple species
mcf05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102123902 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102123902 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    102123902 (SOD2)
   04213 Longevity regulating pathway - multiple species
    102123902 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    102123902 (SOD2)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102123902 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 102123902
NCBI-ProteinID: NP_001274560
UniProt: Q8HXP3
Position
4
AA seq 222 aa AA seqDB search
MLSRAVCGTGRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFEKFKEKLTAASVGVQGSGWGWLGFNKERGQLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccgggcagtttgcggcaccggcaggcagttggcgccggctttggggtatctg
ggctccaggcagaaacacagcctccccgacctgccctacgactacggcgccctggagcct
cacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgttaccgaggagaagtaccaggaggcgttggccaagggagatgttacagcc
cagatagctcttcagcctgcactgaagttcaatggtggtggtcatatcaatcatagcatt
ttctggacaaacctcagccctaatggtggtggagaacccaaaggggagttgctggaagcc
atcaaacgtgactttggttcctttgaaaagtttaaggagaagctgacggctgcatctgtt
ggtgtccaaggctcaggttggggttggcttggttttaataaggaacggggacagttacaa
attgctgcttgtccgaatcaggatccactgcaaggaacaacaggccttattccactgctg
gggattgatgtgtgggagcacgcttattaccttcagtataaaaatgtcaggcctgattac
ctaaaagctatttggaatgtaatcaactgggagaatgtaactgaaagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system