KEGG   Macaca fascicularis (crab-eating macaque): 102124229Help
Entry
102124229         CDS       T02918                                 

Gene name
TSC1
Definition
(RefSeq) tuberous sclerosis 1
  KO
K07206  tuberous sclerosis 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04072  Phospholipase D signaling pathway
mcf04140  Autophagy - animal
mcf04150  mTOR signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04152  AMPK signaling pathway
mcf04211  Longevity regulating pathway
mcf04218  Cellular senescence
mcf04714  Thermogenesis
mcf04910  Insulin signaling pathway
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102124229 (TSC1)
   04151 PI3K-Akt signaling pathway
    102124229 (TSC1)
   04152 AMPK signaling pathway
    102124229 (TSC1)
   04150 mTOR signaling pathway
    102124229 (TSC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102124229 (TSC1)
  09143 Cell growth and death
   04218 Cellular senescence
    102124229 (TSC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102124229 (TSC1)
  09149 Aging
   04211 Longevity regulating pathway
    102124229 (TSC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102124229 (TSC1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102124229 (TSC1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102124229 (TSC1)
   05163 Human cytomegalovirus infection
    102124229 (TSC1)
   05165 Human papillomavirus infection
    102124229 (TSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hamartin ATG16
Motif
Other DBs
NCBI-GeneID: 102124229
NCBI-ProteinID: XP_005580604
Position
15
AA seq 1169 aa AA seqDB search
MAQQANVGELLAMLDSPMLGVRDDVTAVFKENLNSDRGPMLVNTLVDYYLETNSQPALHI
LTTLQEPHDKHLLDRINEYVGKAATRLSILSLLGHVIRLQPSWKHKLSQAPLLPSLLKCL
KMDTDVVVLTTGVLVLITMLPMIPQSGKQHLLDFFDIFGRLSSWCLKKPGHVAEVYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENLETFEEVVKPMMEHVRIHPELVTGSKDH
ELDPRRWKRLETHDVVIECAKISLDPTEASYEDGYSVSHQISARFPHRSADVTTSPYVDT
QNSYGCATSTPYSTSRLMLLNTPGQLPQTLSSPSTRLITEPPQVWCQLATLWSPSMVCGM
TTPPTSPGNVPPDLSHPYSKVFGTTAGGKGTPLGTPATSPPPAPLCHSDDYVHISLPQAT
ATPPRKEERMDSARPCLHRQHHLLNDRGSEEPPGSKGSVTLSDLPGFLGDLASEEDSIEK
DKEEAAISRELSEITTAEAEPVVPRGGFDSPFYRESLPGSQRKTHSAASSAQGASVNPEP
LHSSLDKLGPDTPKQAFTPIDLPCGGAEESPAGDRECQTSLETSILTPSPCKIPPSTRVG
FGSGQPPPYDHLFEVALPKTAHHFVIGKTEELLKKAKGSTEEDGVPSTSPMEVLDRLIQQ
GADAHSKELNKLPLPSKSVDWTHFGGSPPSDEIRTLRDQLLLLHNQLLYERFKRQQHALR
NRRLLRKVIKAAALEEHNAAMKDQLKLQEKDIQMWKVSLQKEQARYSQLQEQRDTMVTKL
HSQIRQLQHDREEFYNQSQELQTKLEDCRNMIAELRIELKKANNKVCHTELLLSQVSQKL
SNSESVQQQMEFLNRQLLVLGEVNELYLEQLQNKHSDTTKEVEMMKAAYRKELEKNRSHV
LQQTQRLDTSQKRILELESHLAKKDHLLLEQKKYLEDVKLQARGQLQAAESRYEAQKRIT
QVFELEILDLYGRLEKDGLLKKLEEEKAEAAEAAEERLDCCNDGCSDSMVGHNEEASGHN
GETKTPRPSSTRGSSGSRGGGGSSSSSSELSTPEKPPHQRAGPFSSRWETTTGEPSASIP
TTVGSLPSSKSFLGMKARELFRNKSESQCDEDGMTSSLSESLKTELSKDLGVEAKTPLNL
DGPHPSPPNPDSVGQLHIMDYNETHHEHS
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atggcccaacaagcgaatgtcggggagctcctcgccatgctggactccccgatgctgggt
gtgcgggacgacgtgacagctgtctttaaagagaacctcaattctgaccgtggtcctatg
cttgtaaacaccttggtggattattacctggaaaccaactctcagccggcgttgcacatc
ctgaccaccttacaagagccacatgacaagcacctcttggacaggattaatgaatatgtg
ggtaaagccgccactcgtttatccatcctctcgttactgggtcatgtcataagactgcag
ccatcttggaagcataagctgtctcaagcacctcttttgccttctttactaaaatgtctc
aagatggacactgacgtcgttgtcctcacaacaggcgtcttggttttgataaccatgcta
ccaatgattccacagtctgggaaacagcatcttcttgatttctttgacatttttggccgt
ctttcatcatggtgtctgaagaaaccaggccacgtggcggaagtctatctcgtccatctc
catgccagtgtgtacgcactctttcatcgcctttatggaatgtacccttgcaactttgtc
tcctttttgcgttctcattacagtatgaaagaaaacctggagacttttgaagaagtggtc
aagccaatgatggagcatgtgcgaattcatccggaattagtgactggatccaaggaccat
gaactggaccctcgaaggtggaagagattagaaactcatgatgttgtgatcgagtgtgcc
aaaatctctctggatcccacagaagcctcatatgaagatggctattctgtgtctcaccaa
atctcagctcgctttcctcatcgttcagccgatgtcaccaccagcccttatgttgacaca
cagaatagctatgggtgtgctacttctaccccttactccacgtctcggctgatgttgtta
aatacgccagggcagctacctcagactctgagttccccatctacacggctgataactgaa
ccaccacaagtatggtgtcaattggctactctttggagcccatctatggtttgtggtatg
accactcctccaacttctcctggaaatgtcccacctgatctgtcacacccttacagtaaa
gtctttggtacaactgcaggtggaaaaggaactcctctgggaaccccagcaacctctcct
cctccagccccactctgtcattcggatgactacgtgcacatttcactcccccaggccaca
gccacaccccccaggaaggaagagagaatggattctgcaagaccatgtctacacagacag
caccatcttctgaatgacagaggatcagaagagccacctggcagcaaaggttctgtcact
ctaagtgatcttccagggtttttaggtgatctggcctctgaagaagatagtattgaaaaa
gataaagaagaagctgcaatatctagagaactttctgagatcaccacagcagaggctgag
cctgtggttcctcgaggaggctttgactctcccttttaccgagagagtctcccaggttct
cagcggaagacccactcggcagcctccagtgctcagggcgccagcgtgaaccctgagcct
ttacactcctccctggacaagcttgggcctgacacaccaaagcaagcctttactcccata
gacctgccctgcggcggtgctgaggaaagccctgcgggagacagggaatgccagacttct
ttggagaccagtatcctcactcccagtccttgtaaaattccaccttcgacaagagtgggc
tttggaagcgggcagcctcccccgtacgatcatctttttgaggtggcattgccaaagaca
gcccatcattttgtcatcgggaagactgaggagcttttaaagaaagcaaaaggaagcaca
gaggaagatggtgtgccctctacctccccaatggaagtgctggacagactgatacagcag
ggagcagacgcgcacagcaaggagctgaacaagttgcctttacccagcaagtctgtcgac
tggacccactttggaggctctcctccttcagatgagatccgcaccctccgagaccagttg
cttttactgcacaaccagttactctacgagcgttttaagaggcagcagcatgccctgcgg
aacaggcggctcctccgcaaggtgatcaaagcagcagctctggaggaacataatgctgcc
atgaaagatcagttgaagttacaagagaaagacatccagatgtggaaggttagtctgcag
aaagaacaagctagatacagtcagcttcaggagcagcgtgacactatggtgaccaagctc
cacagccagatcagacagctgcagcatgaccgagaggaattctacaaccagagccaggaa
ttacagacgaaactggaggactgcaggaacatgattgcagagctgcggatagaattgaag
aaggccaacaacaaggtgtgtcacactgagctgctgctcagtcaggtttcccaaaagctc
tcaaacagtgagtcggtccagcagcagatggagttcttgaacaggcagctgttggttctt
ggggaggtcaacgagctatatttggaacaactgcagaacaagcactcagataccacaaag
gaagtagaaatgatgaaagctgcctatcggaaagagctagaaaaaaacagaagccatgtt
ctccagcagactcagaggcttgacacctcccagaaacggattttggaactggaatcccac
ctggccaagaaagaccaccttcttttggaacagaagaaatatttagaggatgtcaaactc
caggcaagaggacagctgcaggctgcagagagcaggtatgaggctcagaaaaggataacc
caggtgtttgaattggagatcttagatttatatggcaggttggagaaagatggcctcctg
aaaaaacttgaagaagaaaaagccgaagcagctgaagcagcagaagaaaggcttgactgt
tgtaatgacgggtgctcagattccatggtagggcacaatgaagaggcatctggccacaac
ggtgagaccaagacccccaggcccagcagcacccggggcagtagtggaagcagaggaggt
ggaggcagcagcagcagcagcagcgagctttccaccccggagaagcccccacaccagagg
gcgggcccattcagcagtcggtgggagacgacgacgggagaaccgtctgccagcatccct
accactgtgggctcacttcccagttcaaaaagcttcctgggtatgaaggcccgagagtta
tttcgtaataagagcgagagtcagtgtgatgaggacggcatgaccagtagcctttctgag
agcctaaagacggaactgagcaaagacttgggtgtggaagccaagactcccctgaaccta
gatggcccgcacccatctcccccgaacccggacagtgttggacagctacatatcatggac
tacaatgagactcatcatgaacacagctaa

KEGG   Macaca fascicularis (crab-eating macaque): 102140628Help
Entry
102140628         CDS       T02918                                 

Gene name
TSC2
Definition
(RefSeq) tuberous sclerosis 2
  KO
K07207  tuberous sclerosis 2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04072  Phospholipase D signaling pathway
mcf04115  p53 signaling pathway
mcf04140  Autophagy - animal
mcf04150  mTOR signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04152  AMPK signaling pathway
mcf04211  Longevity regulating pathway
mcf04218  Cellular senescence
mcf04714  Thermogenesis
mcf04910  Insulin signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf05163  Human cytomegalovirus infection
mcf05165  Human papillomavirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102140628 (TSC2)
   04151 PI3K-Akt signaling pathway
    102140628 (TSC2)
   04152 AMPK signaling pathway
    102140628 (TSC2)
   04150 mTOR signaling pathway
    102140628 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102140628 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102140628 (TSC2)
   04218 Cellular senescence
    102140628 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102140628 (TSC2)
   04919 Thyroid hormone signaling pathway
    102140628 (TSC2)
  09149 Aging
   04211 Longevity regulating pathway
    102140628 (TSC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102140628 (TSC2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102140628 (TSC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102140628 (TSC2)
   05163 Human cytomegalovirus infection
    102140628 (TSC2)
   05165 Human papillomavirus infection
    102140628 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcf01009]
    102140628 (TSC2)
Protein phosphatases and associated proteins [BR:mcf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102140628 (TSC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tuberin DUF3384 Rap_GAP Cnd1
Motif
Other DBs
NCBI-GeneID: 102140628
NCBI-ProteinID: XP_005590989
Position
20
AA seq 1821 aa AA seqDB search
MAKPTSKDSGLKEKFRILFGLGTPRPNPRSAEGKQTEFIITAEILRELSVECGLSNRIRM
IGQICEVAKTKKFEEHAVEALWKAVADLLQPERPLEARHAVLALLKAIIQGQGERLGVLR
ALFFKVIKDYPSNEDLHERLDVFKALTDNGRHITYLEEELADFVLQWMDVGLSSEFLLVL
VNLVKFNSCYLDEYIARMVQMICLLCVRTASSVDIEVSLQVLDAVVCYNCLPAESLPLFI
VTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCHLMEDRAYMEDAPLLRGAVFFVG
MALWGAHRLYSLRNSPTSVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVTWDI
LLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQERYFELVERCADQRPE
SSLLNLISYRAQSIHPAKDGWIQNLQALMERFFRSESRGAVRIKVLDVLSFVLLINRQFY
EEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLS
PPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKH
SYTLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKKAS
GPLSPPTGPPGPAPAGPAVRLGSLPYSLLFRVLLQCLKQESDWKVLKLVLGRLPESLRYK
VLIFTSPCSVDQLCSALCSMLSGPKTLERLRGAPEGFSRTDLHLAVVPVLTALISYHNYL
DKTKQREMVYCLEQGLIHRCASQCVVALSICSVEMPDIMIKALPVLVVKLTHISATASMA
VPLLEFLSTLARLPQLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNS
PPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSVAQADDSLKSLHL
ELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSL
LGLDSGELQSGPESSSSPGMNVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVG
ALDVPASQFPGSAASPGPQTAPAAKPEKASTGARLPVQQKTNLAAYVPLLTQGWAEILVR
RPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAAST
AKPPPLPRSNTVASFSSLYQSSCQGQLHRSVSWADSAVVMEEGSPGEVPVPVEPPGLEDF
EAALGVDRRTDAYSRSSSTSSQEEKSFHAEELVAGGIPIERAVSSEGGRPSVDLSFQPSQ
PLSKSSSSPELQTLQDILGDPGDKADVGRLSPEVKARSQSGILDGESAAWPASGEDSRGQ
PEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGRRVERDAFKSRATASNAEKVPGINPSFV
FLQLYHSPFFGDESNKPILLPNESQSFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELA
ILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFH
IATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIITPLDYEC
NLVSLQCRKGGARVGPVSLQCRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMASQVH
HSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHTKGPAQTPAEPTP
GYEMGQRKRLISSVEDFTEFV
NT seq 5466 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccaacaagcaaagattcaggcttgaaggagaagtttaggattctgtttgga
ctgggaacaccgaggccaaatcccaggtctgcagagggcaaacagacggaatttatcatc
accgccgaaatcctgagagagctgagtgtggaatgcggcctcagcaatcgcatccggatg
atagggcagatttgtgaagtcgcaaaaaccaagaaatttgaagagcacgcagtggaagca
ctctggaaggcggttgcggatctgttgcagccagaacggccgctggaggcccggcacgcg
gtgctggctctgctgaaggccatcattcaggggcagggcgagcgtttgggggtcctcagg
gccctcttctttaaggtcatcaaggattacccttccaacgaagacctccacgagaggctg
gacgttttcaaggccctcacagacaatgggagacacatcacctacttggaggaagagctg
gcggactttgtcctgcagtggatggatgtcggcttgtcctcggaattccttctggtgctg
gtgaacttggtcaaattcaacagctgttacctcgatgagtacatcgcaaggatggttcag
atgatctgcctgctctgcgtccggaccgcatcctctgtggacatagaggtctccctgcag
gtgctggacgccgtggtctgctacaactgcctgccggctgagagcctcccgctgttcatc
gtcaccctgtgccgcaccatcaatgtcaaggagctctgcgagccttgctggaagctgatg
cggaacctccttggcacccacctgggccacagtgccatctacaacatgtgccacctcatg
gaggacagagcctacatggaggacgcgcccctgctgagaggagccgtgttttttgtgggc
atggctctctggggagcccaccggctctattctctcaggaactcgccgacatcggtgctg
ccatcattttaccaggccatggcatgtccgaacgaggtggtgtcctatgagatcgtcctg
tccatcaccaggctcatcaagaagtataggaaggagctccaggtggtgacgtgggacatt
ctgctgaacatcatcgaacggctccttcagcagctccagaccttggacagcccggagctc
aggaccatcgtccatgacctgctgaccacggtggaggagctgtgtgaccagaatgagttc
cacgggtctcaggagagatactttgaactggtggagagatgtgcagaccagaggcctgag
tcctccctcctgaacctgatctcctacagagcgcagtccattcacccggccaaggacggc
tggattcagaacctgcaggcgctgatggagagattcttcaggagcgagtcccgaggcgcc
gtgcgcatcaaggtgctggatgtgctgtcctttgtgctgctcatcaacaggcagttctac
gaggaggagctgattaactcagtggtcatctctcagctctcccatatccccgaggataaa
gaccatcaggtccgaaagctggccacccagttgctggtggacctggcagagggctgccac
acacaccacttcaacagtctgctggacatcatcgagaaggtgatggcccgctccctctcc
ccacccccggagttggaagaaagggatgtggccgcgtactcggcgtccttggaggatgtg
aagacagctgtcctggggcttctggtcatccttcagactaagctgtacaccctgcctgcg
agccatgccacgcgcgtttatgagatgctggtcagccacattcagctccactacaagcac
agctacaccctgccaatcgccagcagcatccggctgcaggcctttgacttcctgttgctg
ctgcgggccgactcactgcaccgcctcggcctgcccaacaaggatggggtcgtgcggttc
agcccctactgcgtctgcgactacatggagccggagagaggctctgagaagaaggccagc
ggccccctttctcctcccacagggccacctggcccggcgcctgcaggcccggctgtgcgg
ctgggctccctgccctactccctgctcttccgcgtcctgctgcagtgcttgaagcaggag
tctgactggaaggtgctgaagctggttctgggcaggctgcctgagtccctgcgctacaaa
gtactcatctttacctccccttgcagtgtggaccagctgtgctctgctctctgctccatg
ctttcaggcccaaagacactggagcggctccgaggcgccccagaaggcttctccagaact
gacctgcacctggctgtggttccagtgctgacggcattaatctcttaccataactacctg
gacaaaaccaaacagcgcgagatggtctactgcctggagcagggcctcatccaccgctgt
gccagccagtgcgtcgtagccttgtccatctgcagcgtggagatgcctgacatcatgatc
aaggcgctgcccgtcctggtggtgaagctcacacacatctcggccacagccagcatggcc
gtcccgctgctggagttcctgtccactctggccaggctgccgcagctctacaggaacttc
gccgcggagcagtatgccagtgtgttcgccatctcactgccgtacaccaacccctccaag
tttaatcagtacatcgtgtgtctggcccatcacgtcatagccatgtggtttatcaggtgc
cgcctgcccttccggaaggattttgtccctttcatcactaagggcctgcggtccaatgtc
ctcttgtcttttgatgacacccccgagaaggacagcttcagggcccggagtactagtctc
aacgagaggcccaagagtctgaggatagccagaccccccaaacaaggcttgaataactct
ccacccgtgaaagaattcaaggagagctctgcagccgaggccttccggtgccgcagcatc
agtgtgtctgaacatgtggtccgcagcaggatacagacgtccctcaccagtgccagcctg
gggtctgcagacgagaactccgtggcccaggctgacgatagcctgaaaagcctccatctg
gagctgacggaaacctgtctggacatgatggcccgatacgtcttctccaacttcacggct
gtcccgaagaggtctcctgtgggcgagttcctcctggcgggtggcaggaccaaaacctgg
ctggttgggaacaagcttgtcactgtgacgacgagtgtgggaaccgggacccggtcgtta
ctaggcctggactcgggggagctgcagtccggcccggagtcgagctccagccccggcatg
aatgtgagacagacgaaggaggcgccagccaagctggagtcccaggctgggcagcaggtg
tcccgtggggcccgggaccgggtccgttctatgtcagggggccatggtcttcgagttggc
gccctggatgtgccggcctcccagttcccgggcagtgccgcttctccaggaccacagact
gcaccagccgcgaagcctgagaaggcctcgaccggcgcccggcttcctgtgcagcagaag
acgaacctggccgcctacgtgcccctgctgacccagggctgggcggagatcctggtccgg
aggcccacagggaacaccagctggctgatgagcctggagaacccgctcagccctttctcc
tcggacatcaacaacatgcccctgcaggagctgtccaacgccctcatggcagctgagcgc
ttcaaggagcaccgggacacagccctgtacaagtcgctgtcggtgccagcggccagcacg
gccaaaccccctcctctgcctcgctccaacacagtggcctctttctcctccctgtaccag
tccagctgccaaggacagctgcacaggagtgtttcctgggcagactccgccgtggtcatg
gaggagggaagtcctggcgaggttcctgtgccagtggagcccccaggattggaggacttt
gaggcagcgctaggcgtggacaggcgcacagacgcctacagcaggtcgtcctcaacctcc
agccaggaggagaagtcattccacgcagaggagctggtggccgggggaatccccattgaa
cgagccgtctcctcggagggtggccggccctctgtggacctctccttccagccctcacag
cccctgagcaagtctagctcctctcctgagctgcagaccctgcaggacatcctcggggac
cctggggacaaggctgacgtgggccggctgagccctgaggttaaggcccgttcacagtca
gggatcctggacggggaaagtgctgcctggccagcctcgggcgaagacagtcggggccag
cccgagggtcccttgccttccagctccccccgctcacccagtggcctccggccccgcggt
tacaccatctccgactcagccccatcacgcaggggcaggagggtagaaagggatgccttt
aagagcagagccacagcttccaatgcagagaaagtgccaggcatcaaccccagtttcgtg
ttcctgcagctctaccattcgcctttctttggcgacgagtcaaacaagccaatcctgctg
cccaatgagtcacagtcctttgagcggtcggtgcagctcctcgaccagatcccatcatac
gacacccacaagatcgccgtcctgtatgtgggagaaggccagagcaacagtgagctcgcc
atcctgtccaatgagcatggctcctacaggtacacggagttcctgacgggcctgggccgg
ctcatcgagctcaaggactgccagccagacaaggtgtacctgggcggcctggacgtgtgt
ggtgaggacggccagttcacctactgctggcacgacgacatcatgcaagccgtcttccac
atcgccaccctgatgcccaccaaggacgtggacaagcatcgttgcgacaagaagcgccac
ctgggcaacgatttcgtgtccattgtctacaatgactctggcgaggacttcaagctcggc
accatcaagggccagttcaactttgtccacgtgatcatcaccccgctggactatgagtgc
aacctggtgtccctgcagtgcaggaaaggtggggccagggtggggccggtgtccctgcag
tgcaggaaagacatggagggccttgtggacaccagcgtggccaagatcgtgtctgaccgc
aacctgccttttgtggcccgtcagatggccctgcatgcaaacatggcctcacaggtgcac
cacagccgctccaaccccaccgacatctacccctccaagtggattgcccggctccgccac
atcaagagactccgccagcggatctgcgaggaagccgcctactccaaccccagcctgcct
ctggtgcaccccccatcccataccaaagggcctgcacagactccagccgagcccacgcct
ggctacgagatgggccagcggaagcgcctcatctcctctgtggaggacttcaccgagttc
gtgtga

DBGET integrated database retrieval system