KEGG   Macaca fascicularis (crab-eating macaque): 102124337
Entry
102124337         CDS       T02918                                 

Gene name
CD8A
Definition
(RefSeq) CD8a molecule
  KO
K06458  T-cell surface glycoprotein CD8 alpha chain
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04514  Cell adhesion molecules
mcf04612  Antigen processing and presentation
mcf04640  Hematopoietic cell lineage
mcf04660  T cell receptor signaling pathway
mcf05135  Yersinia infection
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102124337 (CD8A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102124337 (CD8A)
   04612 Antigen processing and presentation
    102124337 (CD8A)
   04660 T cell receptor signaling pathway
    102124337 (CD8A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102124337 (CD8A)
  09163 Immune disease
   05340 Primary immunodeficiency
    102124337 (CD8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcf04090]
    102124337 (CD8A)
CD molecules [BR:mcf04090]
 Proteins
  102124337 (CD8A)
SSDB
Motif
Pfam: V-set Ig_3 I-set ig
Other DBs
NCBI-GeneID: 102124337
NCBI-ProteinID: XP_005575419
Position
13
AA seq 276 aa
MRNQAPGRPKGATSPPPLPTGSRAPPVAPELRAEPRPGERVMAPPVTALLLPLVLLLHAA
RPNQFRVSPLGRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGTAARPTFLLYLSQNKPK
AAEGLDTQRFSGKRLGDTFVLTLRDFRQENEGYYFCSALSNSIMYFSHFVPVFLPAKPTT
TPAPRPPTPAPTTASQPLSLRPEACRPAAGGSVNTRGLDFACDIYIWAPLAGACGVLLLS
LVITLYCNHRNRRRVCKCPRPVVKSGGKPSLSDRYV
NT seq 831 nt   +upstreamnt  +downstreamnt
atgcgaaatcaggctccaggccggccgaagggcgcaacttccccccctccgctccccacc
ggctcccgcgcgcctcccgtggcgcccgagcttcgagccgagccgcgtcctggggagcgc
gtcatggccccacccgtgaccgccttgctcctgccgctggtcttgctgctccacgccgcc
aggccaaaccagttccgagtgtcgccgctgggtcggacctggaacctgggagagacggtg
gagctgaagtgccaggtgctgctgtccaacccgacgtcgggctgctcgtggctcttccag
ccgcgcggcaccgccgcccgccccaccttcctcctatacctctcccaaaacaagcccaag
gcggcggaggggctggacacccagcggttctcgggcaagaggttgggggacaccttcgtc
ctcaccctacgtgacttccgccaagagaacgagggctactatttctgctcggccctgagc
aactccatcatgtacttcagccacttcgtgccggtcttcctgccagcgaagcccaccact
acgccagcgccgcgaccacccacaccggcgcccaccaccgcgtcgcagcccctgtccctg
cgcccagaggcgtgccggccagcggcggggggctcagtgaacacaagagggctggacttc
gcctgtgatatctacatctgggcgcccttggccggggcctgcggggtccttctcctgtca
ctggtcatcaccctttactgcaaccacaggaaccgaagacgtgtttgcaaatgtcccagg
cctgtggtcaaatcgggaggcaagcccagcctttcggacagatacgtctaa

DBGET integrated database retrieval system