KEGG   Macaca fascicularis (crab-eating macaque): 102124625
Entry
102124625         CDS       T02918                                 

Gene name
RAG2
Definition
(RefSeq) recombination activating 2
  KO
K10988  recombination-activating protein 2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04068  FoxO signaling pathway
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102124625 (RAG2)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102124625 (RAG2)
SSDB
Motif
Pfam: RAG2 RAG2_PHD Kelch_5 Kelch_3 PHD
Other DBs
NCBI-GeneID: 102124625
NCBI-ProteinID: XP_005578217
UniProt: A0A2K5UMJ1 G7PQD8
Position
14
AA seq 532 aa
MPSENMSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHLDVKHNHV
KLKPTIFSKDSCYLPPLRYPATCTFKGNLESEKHQYIIHGGKTPNNELSDKIYVMSIVCK
NNKRVTFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSV
ADCLPHVFLVDFEFGCATSYILPELQDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYR
IRVDLPLGSPAVNCTVLPGGISVSSAILTQTNKDEFVIVGGYQLENQKRMICNIISLEDN
KIEIREMETPDWTPDIKHSKIWFGSNMGNGTVFLGIPGDNKQVVSEAFYFYTLKCAEDDT
NEEQTTFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFDTYNEDDEEDESETGY
WITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNK
YYCNEHVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKSFLRRLFD
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgccatcagaaaatatgtctctgcagatggtaacagtaagtaataacatagccttaatt
caaccaggcttctcactgatgaattttgatggacaagttttcttctttggccaaaaaggc
tggcccaaaagatcctgccccactggagttttccacttggatgtaaagcataaccatgtc
aaactgaagcctacaattttctctaaggattcctgctacctccctcctcttcgctaccca
gctacttgcacattcaaaggcaacttggagtctgaaaagcatcaatacatcatccatgga
gggaaaacaccaaacaatgagctttcagataagatttatgtcatgtctattgtttgcaag
aacaacaaaagggttacttttcgctgcacagagaaagacttggttggcgatgttcctgaa
gccagatatggtcattccattaatgtggtgtatagccgagggaaaagtatgggtgttctc
tttggaggacgctcatacatgccttctacccacagaaccacagaaaaatggaatagtgta
gctgactgcctgccccatgttttcctggtggattttgaatttgggtgtgctacatcatac
attcttccagaacttcaggatgggctatcttttcatgtctctattgccaaaaatgatacc
atctatattttaggaggacattcacttgccaataatatccggcctgccaacctgtacaga
ataagggttgatcttcccttgggtagcccagctgtgaattgcacagtcttgccaggagga
atctctgtctccagtgcaatcctgactcaaactaacaaggatgaatttgttattgttggt
ggatatcagcttgaaaaccaaaaaagaatgatctgcaacataatctctttagaggacaac
aagatagaaattcgtgagatggagaccccagattggaccccagacattaagcacagcaag
atatggtttggaagcaacatgggaaatggaactgtttttcttggcataccaggagacaat
aaacaagttgtttcagaagcattctatttctatacattgaaatgtgctgaagatgatacg
aatgaagagcaaacaacattcacaaacagtcagacatcaacagaagatccaggggattcc
actccctttgaagactccgaagaattttgtttcagtgcagaagcaaatagttttgatggt
gatgatgaatttgacacctataatgaagatgatgaagaagatgagtctgagacaggctac
tggattacatgctgccctacttgtgacgtggatatcaacacttgggtgccattctattca
accgagctgaataaacccgccatgatctactgttctcatggggatgggcactgggtccat
gctcagtgcatggatctggcagaacgcacgctcatccatctgtcagcaggaagcaacaag
tattactgcaatgagcatgtggagatagcaagagctctacacactccccaaagagtccta
cccttaaaaaagcctccaatgaaatccctccgtaaaaaaggttctggaaaaatcttgact
cctgccaagaaatcctttcttagaaggttgtttgattag

DBGET integrated database retrieval system