KEGG   Macaca fascicularis (crab-eating macaque): 102125865Help
Entry
102125865         CDS       T02918                                 

Gene name
PPARGC1A
Definition
(RefSeq) PPARG coactivator 1 alpha
  KO
K07202  alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04152  AMPK signaling pathway
mcf04211  Longevity regulating pathway
mcf04371  Apelin signaling pathway
mcf04714  Thermogenesis
mcf04910  Insulin signaling pathway
mcf04920  Adipocytokine signaling pathway
mcf04922  Glucagon signaling pathway
mcf04931  Insulin resistance
mcf05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102125865 (PPARGC1A)
   04152 AMPK signaling pathway
    102125865 (PPARGC1A)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102125865 (PPARGC1A)
   04922 Glucagon signaling pathway
    102125865 (PPARGC1A)
   04920 Adipocytokine signaling pathway
    102125865 (PPARGC1A)
  09149 Aging
   04211 Longevity regulating pathway
    102125865 (PPARGC1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    102125865 (PPARGC1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    102125865 (PPARGC1A)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102125865 (PPARGC1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcf03029]
    102125865 (PPARGC1A)
Mitochondrial biogenesis [BR:mcf03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102125865 (PPARGC1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Tox-ODYAM1
Motif
Other DBs
NCBI-GeneID: 102125865
NCBI-ProteinID: XP_005554642
Position
5
AA seq 803 aa AA seqDB search
MDETSPRLEEDWKKVLQREAGWQCAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGL
KWCSDQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDG
DVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHR
IRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDK
CTSKKKSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLT
PPTTPPHKANQDNPFRASPKPKSSCKTAVPPPSKKPRYSESSGTQGNNSTKKGPEQSELY
AQLSKSTVLTGGHEERKTKRHSLRLFGDHDYCQSINSKTEILIHISQELQDSRQLENKDV
SSDWQGQICSSTDSDQCYLRETSEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFD
DEADKTSELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFN
VSPSCSSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRS
SSRSCYYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYE
KRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGD
SYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPAS
TKSKYDSLDFDSLLKEAQRSLRR
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggatgagacctccccaaggctggaagaagactggaaaaaagtacttcagagagaagca
ggctggcagtgtgctgctctggttggtgaagaccagcctctttgtccagatcttcctgaa
cttgatctttctgaactagatgtgaacgacttggatacagacagctttttgggtggactc
aagtggtgcagtgaccaatcagaaataatatccaatcagtacaacaatgagccttcaaac
atatttgagaagatagatgaagagaatgaggcaaacttgctagcagtcctcacagagaca
ctggacagtctccctgtggatgaagacggattgccctcatttgatgcgctgacagatgga
gacgtgaccactgacaatgaggctagtccttcctccatgcctgacggcacccctccaccc
caggaggcagaagagccgtctctacttaagaagctcttactggcaccggccaacactcag
ctaagttataatgaatgcagtggtctcagtacccagaaccatgcaaatcacaatcacagg
atcagaacaaaccctgcaattgttaagactgagaattcatggagcaataaagcgaagagt
atttgtcaacagcaaaagccacaaagacgtccctgctcggagcttctcaaatatctgacc
acaaacgatgaccctcctcacaccaaacccacagagaacagaaacagcagcagagacaaa
tgcacctccaaaaagaagtcccacacacaatcgcagtctcaacatttacaagccaaacca
acaactttatctcttcctctgaccccagagtcaccaaatgaccccaagggttccccattt
gagaacaagactattgaacgcaccttaagtgtggaactctctggaactgcaggcctaact
ccacccaccactcctcctcataaagccaaccaagataacccttttagggcttctccaaag
ccgaagtcctcttgcaagactgcggtgccaccaccatcaaagaagccccggtacagcgag
tcttctggtacacaaggcaataactccaccaagaaagggccggagcaatccgagttgtat
gcacaactcagcaagtccacagtgctcactggtggacacgaggaaaggaagaccaagcgg
cacagtctacggctgtttggtgaccatgactattgccagtcaattaattccaaaacggaa
atactcattcatatatcacaggagctccaagactctagacaactagaaaataaagatgtc
tcctctgattggcaggggcagatttgttcttccacagattcagaccagtgctacctgaga
gagacttcggaggcaagcaagcaggtctctccttgcagcacaagaaaacagctccaagac
caggaaatccgagccgagctgaacaagcacttcggtcatcccagtcaagctgtttttgac
gatgaagcagacaagaccagtgaactgagggacagtgatttcagtaatgaacaattctcc
aaactacctatgtttataaattcaggactagccatggatggcctgtttgatgacagcgaa
gatgaaagtgataaactgagctacccttgggatggcacgcaatcctattcattgttcaat
gtgtctccttcttgctcttcttttaactctccatgtagagattccgtgtcaccacccaaa
tccttattttctcaaagaccccaaaggatgcgctctcgttcaaggtccttttctcgacac
aggtcgtgttcccgatcaccatattccaggtcaagatcaaggtccccaggcagtagatcc
tcttcaagatcctgctattactatgagtcaagccactacagacaccgcacgcaccgaaat
tctcccttgtatgtgagatcacgttcaagatcgccctacagccgtcggcccaggtatgac
agctacgaggagtatcagcacgagaggctgaagagggaagaatatcgcagagagtatgag
aagcgagagtctgagagggccaaacaaagggagaggcagaggcagaaggcaattgaagag
cgccgtgtgatttatgttggtaaaatcagacctgacacaacacggacagaactgagggac
cgttttgaagtttttggtgaaattgaggagtgcacagtaaatctgcgggatgatggagac
agctatggtttcattacctaccgttatacctgtgatgcttttgctgctcttgaaaatgga
tacactttgcgcaggtcaaacgaaactgacttcgagctgtacttttgtggacgcaagcaa
tttttcaagtctaactatgcagacctagattcaaactcagatgactttgaccctgcttcc
accaagagcaagtatgactctctggattttgatagtttactgaaagaagctcagagaagc
ttgcgcaggtaa

DBGET integrated database retrieval system