KEGG   Macaca fascicularis (crab-eating macaque): 102126054Help
Entry
102126054         CDS       T02918                                 

Gene name
DHX8
Definition
(RefSeq) DEAH-box helicase 8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102126054 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcf03041]
    102126054 (DHX8)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102126054 (DHX8)
Spliceosome [BR:mcf03041]
 Complex C
  Other components
   Step II factors
    102126054 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH Sigma54_activ_2 Presenilin
Motif
Other DBs
NCBI-GeneID: 102126054
NCBI-ProteinID: XP_005584415
UniProt: A0A2K5VPX1
Position
16
AA seq 1222 aa AA seqDB search
MAVAVAMAGAIVGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPVKPSTSKDPVVKPKTEKEKLKELFP
VLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAVQEKQRDTEHRDRTKKKKRSRSR
DRDRDRDRDRDRERNRERDHKRRHRSRSRSRSRTRERNKAKSRYRSRSRSQSPPKDRKDR
DKYGERNLDRWRDKHVDRPPPEEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHIS
ELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQESGEDLNPNRRRNLVGET
NEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPD
FDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMM
QSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEW
KKHAFGGNKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQI
TQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVI
KYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSA
TLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILV
FLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIA
TNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGK
CYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAM
EQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVF
YRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDI
RKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPS
SALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRL
EPLYNRYEEPNAWRISRAFRRR
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggctgtagccatggcgggagccatagtcgggtcggagccgggccccgcggaa
gaacttgccaaactcgagtacctgtctttggtgtcaaaggtttgcactgagctggacaat
cacttggggatcaacgacaaggaccttgctgaatttgtgatcagtcttgctgagaaaaat
accacctttgatacttttaaggcttccctcgtcaaaaatggtgcagaatttacggattct
cttattagtaacttgctgcgtctcatacaaaccatgcggcctccagtgaagccttccact
agcaaagatccagttgttaaacctaaaacagaaaaagaaaaactgaaggaactcttccca
gtcctttgccaaccggacaacccttctgttcggaccatgttggatgaagatgatgtgaaa
gttgctgtggatgtcctgaaagaactggaagctttaatgcccagtgcagcagtccaggag
aagcagagagatactgagcaccgggacaggacaaagaagaagaagcggagtcgaagccga
gatcgagaccgagatcgagatcgagaccgagatagggaacgaaaccgagagagagaccac
aagcggagacaccgatcccgctctcgatcacgttccaggacccgggagaggaataaagca
aagtctagatatcggtccaggagcaggagtcagagtccccccaaagaccggaaggaccgg
gacaaatatggagagcggaatctggatagatggcgggataagcatgtggaccgccctcct
ccagaagagcccaccattggtgacatttataatggcaaagttaccagcatcatgcagttt
ggttgctttgtgcagctggaaggactcaggaagcgatgggaaggcctggtgcacatctct
gagctccggcgggagggtcgtgtggccaatgtagctgatgtggtgagcaaaggccagagg
gtcaaagtcaaagtgctctccttcactgggaccaagaccagcctgagcatgaaggatgtg
gatcaagagtctggagaagatctaaacccaaatagacggcgaaatcttgtcggggagacc
aatgaggagacctcaatgcggaatcctgatagacccactcacctgtcccttgtcagtgcc
cctgaagtagaggacgactcactggaacgcaagcgcctcacccgaatctctgacccagag
aagtgggagatcaaacagatgattgctgccaatgtcctttccaaagaagagtttccagac
tttgatgaagagactggcattctccctaaggtggatgatgaggaagatgaggaccttgag
attgaattggttgaggaagagcctccattcctgagaggacacactaagcaaagcatggac
atgagccccattaaaatcgtcaagaacccagatggctccctctcccaagcagcaatgatg
cagagtgccttggccaaagaaaggcgggaacttaagcaggcccagcgggaagctgagatg
gattctattcccatgggactcaacaaacactgggttgaccctctgcctgatgcggaaggc
agacagattgctgccaacatgcggggtattgggatgatgcccaatgatattcccgagtgg
aagaagcatgcctttgggggcaataaagcctcttacgggaaaaagacccagatgtcaatc
cttgagcaaagggagagcctgccaatctacaaactgaaggagcagttggtccaggctgtc
catgacaatcagatcctgattgttattggtgagacaggatctggaaagacaacgcagatc
acccagtacctggcagaggcaggctacacttccaggggcaagattgggtgtacccagccc
agaagagtggcagctatgtcagtggccaaaagagtgtcggaggagtttggttgttgctta
ggccaagaggtgggctacactattcgatttgaggactgcactagccctgaaacagtcatc
aagtacatgacagatgggatgttgcttagagagtgcttgattgaccctgacctcactcag
tatgcgatcatcatgttggacgaagcgcacgagaggacaattcacactgatgtgctcttt
ggattgttgaaaaagacagttcagaaacggcaggacatgaagctgattgtcacctcagcc
accttggatgcagtgaagttttctcaatacttctatgaagctcccattttcaccatccca
ggtcgaacatatccagtggaaatactgtacacaaaggaacctgagacagattatttggat
gccagcctgattactgttatgcagatccatttaacagagccaccaggtgatatcctggtc
ttcctgactggtcaggaagaaattgatactgcttgtgagatcctgtatgaaagaatgaaa
tccctgggacctgatgttccagagttaattatcctcccagtgtactctgctcttcccagt
gagatgcagacccgaatctttgacccagctccaccaggcagcagaaaggttgtgattgcc
accaatattgcagagacatcgctgactattgatggtatctactatgtggtggacccagga
tttgtgaagcagaaagtttacaattccaagacagggattgaccagctcgtggtaacgcct
atttctcaggctcaggcaaagcaacgagctggcagagctgggagaacaggcccaggaaag
tgttacaggctgtacacagaacgtgcctaccgagatgaaatgctgaccacaaacgtgccg
gaaatccagagaaccaacttagcaagcacagtgctgtcactcaaggccatgggtatcaat
gatctgctgtcctttgatttcatggatgccccaccaatggaaactttgatcacagccatg
gagcagctgtacacactgggagccctggatgacgagggcctgcttactcgcttgggccgc
cggatggcagagttccctctggagccaatgctatgcaaaatgctcatcatgtctgtgcat
ctgggctgcagtgaggaaatgctgaccattgtatccatgttgtctgtgcagaacgtcttc
tataggcccaaggataaacaagcccttgcagatcagaagaaggccaaattccaccagact
gaaggggaccacctcaccctgctagctgtgtacaactcctggaagaacaacaagttctcc
aacccatggtgctatgagaactttatccaggctcgttccctgcgccgggcccaggacatt
cgcaagcagatgttaggcataatggacagacacaagctggatgttgtttcctgtggcaag
tccacagtccgagtgcagaaggccatctgcagtgggttcttccgtaatgctgccaagaaa
gacccgcaggagggttaccgaacactgatcgaccagcaggtggtctatatccatccttcc
agtgctctcttcaacagacagccagaatgggtggtgtaccatgagctggtgctgaccacc
aaggaatacatgcgtgaagttaccaccatcgaccctcggtggcttgtggagtttgctcca
gccttcttcaaggtctcagacccaactaagctaagcaaacagaagaagcaacagcgtctt
gaacccttgtacaaccgctatgaggaacccaacgcctggagaatatcccgggccttccga
cggcgctga

DBGET integrated database retrieval system