KEGG   Macaca fascicularis (crab-eating macaque): 102126290Help
Entry
102126290         CDS       T02918                                 

Gene name
ZDHHC24
Definition
(RefSeq) zinc finger DHHC-type containing 24
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102126290 (ZDHHC24)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     102126290 (ZDHHC24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 102126290
NCBI-ProteinID: XP_005577207
UniProt: A0A2K5U6Y0
Position
14
AA seq 284 aa AA seqDB search
MGQPWAAGSADGAPARLPLVLTALWAAAVGLELAYVLVLGPGPPPLGPLARALQLALAAF
QLLNLLGNVGLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRR
DHHCRLLGRCVGFGNYRPFLCLLLHAAGVLLHISVLLGPALSALLRAHTPLHMAALLLLP
WLMLLTGRVSLAQFALAFVTDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQHSYDLG
PCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTAS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggggcagccctgggcggctgggagcgcggacggggcgcccgcgcggctgcctctcgtg
ctcaccgcgctgtgggccgcggccgtgggcctggagctggcttacgtgctggtgctcggt
cccgggccgcccccgctgggacccctggcccgggccttgcagctggcgttggccgccttc
cagctgctcaacctgctgggcaacgtggggctcttcctgcgctcggatcccagcatccgg
ggcgtgatgctggccggccgcggtctgggccagggctgggcttactgctaccagtgccaa
agccaggtgccgccacgcagcggacactgctctgcctgccgcgtctgcatcctgcgtcgg
gaccaccactgccgactgctgggccgctgcgtgggcttcggcaactaccggccgttcctg
tgcctgctgcttcatgctgccggtgtcctgctccacatctctgtgctgctgggacctgca
ctatcggccctgctgcgagcccacacgcccctccacatggctgccctcctgctgcttccc
tggctcatgctgctcacaggcagagtgtctctggcacagttcgccttggccttcgtgacg
gacacgtgcgtggcgggtgcgctgctgtgtggggctgggctgctcttccatgggatgctg
ctgctgcggggccagaccacatgggagtgggctcggggccagcactcctatgacctgggt
ccctgccacaacctgcaggcagccctggggccccgctgggcccttgtctggctctggccc
ttcctggcttccccattgccaggggatgggatcaccttccagaccacagcagatgtggga
cacacagcctcctga

DBGET integrated database retrieval system