KEGG   Macaca fascicularis (crab-eating macaque): 102126339Help
Entry
102126339         CDS       T02918                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf04010  MAPK signaling pathway
mcf04012  ErbB signaling pathway
mcf04014  Ras signaling pathway
mcf04024  cAMP signaling pathway
mcf04068  FoxO signaling pathway
mcf04071  Sphingolipid signaling pathway
mcf04137  Mitophagy - animal
mcf04140  Autophagy - animal
mcf04141  Protein processing in endoplasmic reticulum
mcf04210  Apoptosis
mcf04215  Apoptosis - multiple species
mcf04217  Necroptosis
mcf04310  Wnt signaling pathway
mcf04380  Osteoclast differentiation
mcf04510  Focal adhesion
mcf04530  Tight junction
mcf04620  Toll-like receptor signaling pathway
mcf04621  NOD-like receptor signaling pathway
mcf04622  RIG-I-like receptor signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04657  IL-17 signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04664  Fc epsilon RI signaling pathway
mcf04668  TNF signaling pathway
mcf04722  Neurotrophin signaling pathway
mcf04723  Retrograde endocannabinoid signaling
mcf04728  Dopaminergic synapse
mcf04750  Inflammatory mediator regulation of TRP channels
mcf04910  Insulin signaling pathway
mcf04912  GnRH signaling pathway
mcf04914  Progesterone-mediated oocyte maturation
mcf04917  Prolactin signaling pathway
mcf04920  Adipocytokine signaling pathway
mcf04926  Relaxin signaling pathway
mcf04930  Type II diabetes mellitus
mcf04931  Insulin resistance
mcf04932  Non-alcoholic fatty liver disease (NAFLD)
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf05132  Salmonella infection
mcf05133  Pertussis
mcf05135  Yersinia infection
mcf05142  Chagas disease (American trypanosomiasis)
mcf05145  Toxoplasmosis
mcf05152  Tuberculosis
mcf05161  Hepatitis B
mcf05162  Measles
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05200  Pathways in cancer
mcf05210  Colorectal cancer
mcf05212  Pancreatic cancer
mcf05231  Choline metabolism in cancer
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102126339 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102126339 (MAPK8)
   04010 MAPK signaling pathway
    102126339 (MAPK8)
   04012 ErbB signaling pathway
    102126339 (MAPK8)
   04310 Wnt signaling pathway
    102126339 (MAPK8)
   04668 TNF signaling pathway
    102126339 (MAPK8)
   04068 FoxO signaling pathway
    102126339 (MAPK8)
   04071 Sphingolipid signaling pathway
    102126339 (MAPK8)
   04024 cAMP signaling pathway
    102126339 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102126339 (MAPK8)
   04137 Mitophagy - animal
    102126339 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    102126339 (MAPK8)
   04215 Apoptosis - multiple species
    102126339 (MAPK8)
   04217 Necroptosis
    102126339 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102126339 (MAPK8)
   04530 Tight junction
    102126339 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102126339 (MAPK8)
   04621 NOD-like receptor signaling pathway
    102126339 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    102126339 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    102126339 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    102126339 (MAPK8)
   04659 Th17 cell differentiation
    102126339 (MAPK8)
   04657 IL-17 signaling pathway
    102126339 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    102126339 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102126339 (MAPK8)
   04920 Adipocytokine signaling pathway
    102126339 (MAPK8)
   04912 GnRH signaling pathway
    102126339 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    102126339 (MAPK8)
   04917 Prolactin signaling pathway
    102126339 (MAPK8)
   04926 Relaxin signaling pathway
    102126339 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    102126339 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    102126339 (MAPK8)
   04722 Neurotrophin signaling pathway
    102126339 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102126339 (MAPK8)
  09158 Development
   04380 Osteoclast differentiation
    102126339 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102126339 (MAPK8)
   05231 Choline metabolism in cancer
    102126339 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102126339 (MAPK8)
   05212 Pancreatic cancer
    102126339 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102126339 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102126339 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102126339 (MAPK8)
   04931 Insulin resistance
    102126339 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102126339 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102126339 (MAPK8)
   05135 Yersinia infection
    102126339 (MAPK8)
   05133 Pertussis
    102126339 (MAPK8)
   05152 Tuberculosis
    102126339 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102126339 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    102126339 (MAPK8)
   05162 Measles
    102126339 (MAPK8)
   05161 Hepatitis B
    102126339 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102126339 (MAPK8)
   05169 Epstein-Barr virus infection
    102126339 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102126339 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    102126339 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102126339 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102126339 (MAPK8)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102126339 (MAPK8)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102126339 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 DUF530
Motif
Other DBs
NCBI-GeneID: 102126339
NCBI-ProteinID: XP_005565231
UniProt: G7PEU4
Position
9
AA seq 427 aa AA seqDB search
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggctcaggagcgcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttacgtagtgactcgctactacagagcacccgaggtcatccttggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagcttcgagaaactcttccctgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

DBGET integrated database retrieval system