KEGG   Macaca fascicularis (crab-eating macaque): 102126451
Entry
102126451         CDS       T02918                                 

Gene name
TNFRSF13B
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 13B
  KO
K05150  tumor necrosis factor receptor superfamily member 13B
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04672  Intestinal immune network for IgA production
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102126451 (TNFRSF13B)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102126451 (TNFRSF13B)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102126451 (TNFRSF13B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102126451 (TNFRSF13B)
   04090 CD molecules [BR:mcf04090]
    102126451 (TNFRSF13B)
Cytokine receptors [BR:mcf04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102126451 (TNFRSF13B)
CD molecules [BR:mcf04090]
 Proteins
  102126451 (TNFRSF13B)
SSDB
Motif
Pfam: TACI-CRD2 BCMA-Tall_bind
Other DBs
NCBI-GeneID: 102126451
NCBI-ProteinID: XP_005583052
UniProt: A0A2K5VNU0
Position
16
AA seq 293 aa
MSGLGQSRRGGRSRVDQEERSPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKAICNHQSQR
TCATFCRSLNCRKEQGRFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRR
QRSGEVENNSDNSGRYQGSEHRGSEASPALPGLKLSADQLALVYSTLGLCLCAVLCCFLV
TVACFLKKRGDPCSCQPRSRSCQNPAKSSQDHAMEAGSPVGTSPEPVETCSFCFPECRAP
TQESAVMPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA
NT seq 882 nt   +upstreamnt  +downstreamnt
atgagtggcctgggccagagcaggcgaggtggccggagccgtgtggaccaggaggagcgg
tctccacagggcctgtggacaggggtggctatgagatcctgccccgaagagcagtactgg
gatcccctgctgggcacctgcatgtcctgcaaagccatttgcaaccatcagagccagcgc
acctgtgcaaccttctgcaggtcactcaactgccgcaaggagcaaggcaggttctatgac
catctcctgagggactgcatcagctgtgcctccatctgtggacagcaccctaagcaatgt
gcatacttctgtgagaacaagctcaggagcccagtgaacctcccaccagagctcaggaga
cagcggagtggagaagttgaaaacaattcagacaactcgggaaggtaccaaggatcagag
cacagaggctcagaagcaagtccagctctcccggggctgaaactgagtgcagatcagctg
gccctggtctacagcacgctggggctctgcctgtgtgccgtcctctgctgcttcctggtg
acagtggcctgcttcctcaagaagaggggggatccctgctcctgccagccccgctcaagg
tcctgtcaaaatccggccaagtcttcccaggatcacgcgatggaagctggcagccctgtg
ggcacatcccctgagccagtggagacctgcagcttctgcttccccgagtgcagggcgccc
acccaggagagtgcagtcatgcctgggacccccgaccccacttgtgctggaaggtggggg
tgccacaccaggaccacagtcctgcagccttgcccccacatcccagacagtggtcttggc
attgtgtgtgtgcctgcccaggaagggggcccaggtgcataa

DBGET integrated database retrieval system