KEGG   Macaca fascicularis (crab-eating macaque): 102127018Help
Entry
102127018         CDS       T02918                                 

Gene name
NDST4
Definition
(RefSeq) N-deacetylase and N-sulfotransferase 4
  KO
K02579  heparan sulfate N-deacetylase/N-sulfotransferase NDST4 [EC:3.1.1.- 2.8.2.-]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
mcf01100  Metabolic pathways
Module
mcf_M00059  Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    102127018 (NDST4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mcf01003]
    102127018 (NDST4)
Enzymes [BR:mcf01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     102127018 (NDST4)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     102127018 (NDST4)
Glycosyltransferases [BR:mcf01003]
 Unclassified
  Sulfotransferases
   102127018 (NDST4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSNSD Sulfotransfer_1 Sulfotransfer_3
Motif
Other DBs
NCBI-GeneID: 102127018
NCBI-ProteinID: XP_005555842
UniProt: G7P653
Position
5
AA seq 872 aa AA seqDB search
MNLIVKLRRSFRTLIVLLATFCLVSIVISAYFLYSGYKQEMTLIETTAEAECADIKILPY
RSMELKTVKPIDTSKTDPTVLLFVESQYSQLGQDIIAILESSRFQYHMVIAPGKGDIPPL
TDNGKGKYTLVIYENILKYVSMDSWNRELLEKYCVEYSVSIIGFHKANENSLPSTQLKGF
PLNLFNNLALKDCFVNPQSPLLHITKAPKVEKGPLPGEDWTIFQYNHSTYQPVLLTELQT
EKSLSSLSSKKLFATVIQDLGLHDGIQRVLFGNNLNFWLHKLIFIDAISFLSGKRLTLSL
DRYILVDIDDIFVGKEGTRMNVKDVKALLETQNLLRTQVANFTFNLGFSGKFYHTGTEEE
DEGDDLLLRSVDEFWWFPHMWSHMQPHLFHNESSLVEQMILNKEFALEHGIPINMGYAVA
PHHSGVYPVHIQLYAAWKKVWGIQVTSTEEYPHLKPARYRKGFIHNSIMVLPRQTCGLFT
HTIFYKEYPGGPQELDKSIRGGELFLTILLNPISIFMTHLSNYGNDRLGLYTFVNLANFV
QSWTNLKLQTLPPVQLAHKYFELFPEQKDPLWQNPCDDKRHKDIWSREKTCDHLPKFLVI
GPQKTGTTALYLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGLDWYMDFFPTPSNTTS
DFLFEKSANYFHSEEAPKRAASLVPKAKIIAILIDPSDRAYSWYQHQRSHEDPAALRFNF
YEVISAGHWAPSDLKTLQRRCLVPGWYAVHIERWLTYFATSQLLIIDGQQLRSDPATVMD
EVQKFLGVTPHYNYSEALTFDPQKGFWCQLLEGGKTKCLGKSKGRKYPPMDPESRTFLSN
YYRDHNVELSKLLHRLGQPLPSWLRQELQKVR
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttattgtgaaacttcggagaagttttcgaacattgattgttctcttagctacc
ttttgcttggtgagcattgtcatttctgcctattttctctactctggctacaaacaggaa
atgacacttatcgaaaccactgcagaagcagaatgcgctgacatcaaaattctaccatat
cggtcaatggagctgaaaacagtgaaacctattgatacatccaaaactgaccctactgtc
cttctctttgtggagagccaatactctcaacttggtcaagatatcatagctattttggag
tccagccgatttcagtaccacatggtcattgcccctggaaagggagatatacctcctctt
acagataatggcaaagggaaatatactttagttatttatgaaaatattctgaagtacgtc
agcatggactcatggaatcgagagcttttagaaaaatactgtgtggaatacagtgttagt
ataatcggttttcataaagccaatgagaacagcttaccaagtacacaattaaaaggcttt
ccgttaaaccttttcaataatctagctctaaaggactgttttgttaaccctcaatctcct
ttgctacatattaccaaagcccccaaggttgagaaaggccctcttcctggggaagactgg
actattttccaatataatcattcaacctaccagcctgtacttttaactgaattacagaca
gaaaaatccctttcatccttgtctagcaaaaaactctttgcaacggtgattcaggatctg
gggcttcatgatggaattcagcgagtactttttggcaacaacttgaacttttggctgcac
aagctcatcttcatagatgccatctccttcttgtcagggaagaggctgacattgtccttg
gacaggtacatccttgtggacattgatgatatatttgttgggaaagagggaacaaggatg
aatgtcaaagatgtgaaggcattactagagactcaaaatttactgcgcactcaggttgca
aattttaccttcaaccttggattttcagggaagttttaccacacagggactgaagaggaa
gatgaaggagatgaccttttacttcggtctgtggatgagttctggtggtttcctcacatg
tggagccacatgcagccccacctcttccacaatgagtcatctttagtagagcagatgatt
ctcaacaaggaatttgcactggaacatggaataccaatcaacatgggctatgctgtggcc
ccacatcactcaggggtctacccagttcacattcagctgtatgcagcttggaagaaggtc
tggggtattcaagtcaccagcactgaagaatatccacatctgaaacctgcccggtacaga
aagggcttcattcacaatagcatcatggtcctccctcgacagacttgtgggttgttcact
cacactattttctacaaagaatatccaggaggaccccaagaactggataaaagtatcaga
ggaggtgaactttttctcacaatccttctaaacccaatcagcattttcatgacccattta
tcaaactatggaaatgaccgcctagggttgtatacctttgtgaacttggccaactttgtg
cagagctggaccaacctgaaattgcaaactctgcctccagtgcagctggcccacaagtat
tttgagctcttccctgagcagaaagaccctctatggcagaatccatgtgatgataaacga
cacaaagacatctggtccagagagaaaacttgtgaccacttaccaaaatttctagtaatt
ggtccacaaaaaacaggaacaactgcactttatttatttcttctaatgcatccttcaatc
atcagcaatctccctagtccaaagacatttgaggaagttcagttctttaatggcaacaac
tatcacaagggattagactggtatatggactttttccctacaccatccaatactacaagt
gactttctgtttgaaaagagtgctaattacttccattcggaggaagctcccaaacgagct
gcatctcttgtccccaaagccaagatcatcgccatccttattgacccctcagacagggca
tactcttggtaccagcaccaacgatcacatgaagatccagctgctctgaggttcaatttc
tatgaagttatttcagcaggacattgggctccatctgacttaaaaactttgcagagaaga
tgcctagtacctggatggtatgcagtccacatagaaagatggctaacttactttgctact
tctcagttgctaattattgatggacagcagctgagatctgacccagctactgtgatggat
gaagtccagaagtttctgggagttacacctcattataattactctgaagcactaacgttt
gatccccaaaagggtttttggtgtcaattactggaaggaggaaagacaaaatgccttgga
aaaagcaaaggccgaaaatatccacctatggatccagagtctagaactttcctctctaat
tactaccgagatcataacgtggaactatccaaactgctacacagactgggacagcctctg
ccatcatggctgagacaggaactgcagaaagtgagatag

DBGET integrated database retrieval system