KEGG   Macaca fascicularis (crab-eating macaque): 102127382Help
Entry
102127382         CDS       T02918                                 

Gene name
CNR1
Definition
(RefSeq) cannabinoid receptor 1
  KO
K04277  cannabinoid receptor 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04015  Rap1 signaling pathway
mcf04080  Neuroactive ligand-receptor interaction
mcf04714  Thermogenesis
mcf04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102127382 (CNR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102127382 (CNR1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    102127382 (CNR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102127382 (CNR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcf04030]
    102127382 (CNR1)
G protein-coupled receptors [BR:mcf04030]
 Rhodopsin family
  Others
   Cannabinoid
    102127382 (CNR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx YlaC
Motif
Other DBs
NCBI-GeneID: 102127382
NCBI-ProteinID: XP_005552444
UniProt: G7P3K6
Position
4
AA seq 472 aa AA seqDB search
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgatcctagatggccttgcagataccaccttccgcaccatcaccactgacctc
ctgtacgtgggctcaaatgacattcagtacgaagacatcaaaggtgacatggcatccaaa
ttagggtacttcccacagaaattccctttaacttcctttaggggaagtcccttccaagag
aagatgactgcgggagacaacccccagctagtcccagcagaccaggtgaacattacagaa
ttttacaacaagtctctctcatccttcaaggagaatgaggagaacatccagtgtggggag
aacttcatggacatagagtgcttcatggtcctgaaccccagccagcagctggccattgca
gtcctgtccctcacgctgggcaccttcacggtcctggagaacctcctggtgctgtgtgtc
atcctccactcccgcagcctccgctgcaggccttcctaccacttcatcggcagcctggcg
gtggcagacctcctggggagcgtcatttttgtctacagcttcattgacttccatgtgttc
caccgcaaagatagccgcaatgtgtttctgttcaaactgggtggggtcacagcctccttc
actgcctctgtgggcagcctgttcctcacggccatcgacaggtacatatccattcacagg
cccctggcctataagaggatcgtcaccaggcccaaggctgtggtggcgttttgcctgatg
tggaccatagccattgtgattgccgtgctgcctctcctgggctggaactgtgagaaactg
caatctgtttgctcagacattttcccacacattgatgaaacctacctgatgttctggatc
ggggtcaccagcgtgctgcttctgttcatcgtgtatgcgtacatgtacattctctggaag
gctcacagccacgccgtccgcatgattcagcgtggcacccagaagagcatcatcatccac
acgtctgaggatgggaaggtacaggtgacccggccggaccaagcccgcatggacattagg
ttagccaagaccctggtcctgatcctggtggtgttgatcatctgctggggccctctgctt
gcaatcatggtgtatgatgtctttgggaagatgaacaagctcattaagacagtgtttgca
ttctgcagtatgctctgcctgctgaactccaccgtgaaccccatcatctatgctctgagg
agtaaggacctgcgacacgctttccggagcatgtttccctcttgtgaaggcaccgcgcag
cctctggataacagcatgggggactcggactgcctgcacaaacacgcaaacaacgcagcc
agtgttcacagggccgcagaaagctgcatcaagagcacggtcaagattgccaaggtaacc
atgtctgtgtccacagacacgtctgccgaggctctgtga

DBGET integrated database retrieval system