KEGG   Macaca fascicularis (crab-eating macaque): 102127914
Entry
102127914         CDS       T02918                                 

Gene name
RAG1
Definition
(RefSeq) recombination activating 1
  KO
K10628  V(D)J recombination-activating protein 1 [EC:2.3.2.27]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04068  FoxO signaling pathway
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102127914 (RAG1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102127914 (RAG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcf04121]
    102127914 (RAG1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102127914 (RAG1)
Ubiquitin system [BR:mcf04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102127914 (RAG1)
SSDB
Motif
Pfam: RAG1 RAG1_imp_bd zf-RAG1 zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-RING_2 zf-RING_10 zf-C3HC4_4
Other DBs
NCBI-GeneID: 102127914
NCBI-ProteinID: XP_005578229
UniProt: A0A2K5UF18
Position
14
AA seq 1043 aa
MASSFPPTLGLSSAPDEIQHPYIKFSEWKFKLFRVRSFEKTPEEAQREKKDSFEGKPSLE
QSPAVLDKADGQKPVPNQPVLKAHPKFSKKFHDTGKARVKAIHQANLRHLCRICGNSFKT
DEHNRRYPVHGPVDGKTLGLLRKKEKRATSWPDLITKVFRIDVKADVDSIHPTEFCHNCW
SIMHRKFSSAPCEVYFPRNVTVEWHPHTPSCDICNTARRGLKRKSLQPNLQLSKKLKTVL
DQARQARQRKRRAQARTSSKDVMKKIANCSKIHLSTKLLAVDFPEHFVKSISCQICEHIL
ADPVETNCKHVYCRVCILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLSILNSLMVKCPA
KECNQEVSLEKYNHHISSHKESKENFVHINKGGRPRQHLLSLTRRAQKHRLRELKLQVKA
FADKEEGGDVKSVCMTLFLLALRARNEHRQADELEAIMQGKGSGLQPAVCLAIRVNTFLS
CSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHHFEWQPPLKNVSSSTDVGIIDG
LSGLSSSVDDYPVDTIAKRFRYDSALVSALMDMEEDILEGMRSQDLDDYLNGPFTVVVKE
SCDGMGDVSEKHGSGPVVPEKAVRFSFTIMKITIAHSSQNVKVFEEAKPNSELCCKPLCL
MLADESDHETLTAILSPLIAEREAMKSSELMLELGGILRTFKFIFRGTGYDEKLVREVEG
LEASGSVYICTLCDATRLEASQNLVFHSITRSHAENLERYEVWRSNPYHESVEELRDRVK
GVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKNPNASKEERKRWQATLDKHL
RKKMNLKPIMRMNGNFARKLMTKETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSC
PAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWA
SEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNALKTSGFNMD
SQASLGDPLGIEDSLESQDSMEF
NT seq 3132 nt   +upstreamnt  +downstreamnt
atggcgtcctctttcccacccaccttgggactcagttctgccccagatgaaattcagcac
ccatatattaaattttcagaatggaaatttaagctgttccgggtgagatcctttgaaaag
acacctgaagaagctcaaagggaaaagaaggattcctttgaggggaagccctctctggag
caatctccagcagtcctggacaaggctgatggtcagaagccagtcccaaatcagccagtg
ttaaaagcccatcctaagttttcaaagaaatttcatgacactgggaaagcaagagttaaa
gccatccatcaagccaaccttcgacatctctgccgcatctgtgggaattcttttaaaact
gatgagcacaacaggagatatccagttcatggtcctgtggatggtaaaaccctaggcctt
ttacgaaagaaggaaaagagagctacttcctggccagacctcattaccaaggttttccgg
attgatgtgaaggcagatgttgactcgatccaccccactgagttctgccataactgctgg
agcatcatgcacaggaagtttagcagtgccccttgtgaggtttacttcccgaggaatgtg
accgtggagtggcacccccacacaccatcctgtgacatctgcaacactgcccgtcgggga
ctcaagaggaagagtcttcagccaaacttgcagctcagcaaaaaactcaaaactgtgctt
gaccaagcaagacaagcccgtcagcgcaagagaagagctcaggcaaggaccagcagcaag
gatgtcatgaagaagatcgccaactgcagtaagatacatcttagtaccaagctgcttgca
gtggacttcccggagcacttcgtgaaatccatctcctgccagatctgtgaacacattctg
gccgaccctgtggagaccaactgtaagcatgtctattgccgggtctgcattctcagatgc
ctcaaagtcatgggcagctattgtccctcttgccgatatccatgcttccctactgacctg
gagagtccagtgaagtcctttctgagcatcttgaattccctgatggtgaaatgtccagca
aaagagtgcaatcaggaggtcagtttggaaaaatataatcaccacatctcaagtcacaag
gaatcaaaagagaattttgtgcacattaataaagggggccggccccgccaacatcttctg
tcgctgactcggagagctcagaagcaccggctgagggagctcaagctgcaagtcaaagcc
tttgctgacaaagaagaaggtggagatgtgaagtcggtgtgcatgaccttgttcctgctg
gctctgagggcgaggaatgagcacaggcaagccgacgagctggaggccatcatgcaggga
aagggctctggcctgcagccagctgtttgcttggccatccgtgtcaacaccttcctcagc
tgcagtcagtaccacaagatgtacaggactgtgaaagccatcacagggagacagattttt
cagcctttgcatgcccttcggaatgctgagaaggtacttctgccgggctaccaccacttt
gagtggcagccacctctgaagaatgtgtcttccagcactgatgttggcattattgatggg
ctgtctggactatcatcctctgtggatgattacccagtggacaccattgccaagaggttc
cgctatgattcagctttggtgtctgctttgatggacatggaagaagacatcttggaaggc
atgagatcccaagaccttgatgattacctgaatggccccttcacagtggtggtgaaggag
tcttgtgatggaatgggagatgtgagtgagaagcacgggagtgggccagtagttccagaa
aaggcagtccgtttttcattcacaatcatgaaaattactatcgcccacagctctcagaat
gtgaaagtatttgaggaagccaaacctaactctgaactgtgttgcaagccattgtgcctt
atgctggcagatgagtctgaccacgagacactgactgccatcctgagccctctcattgct
gagagggaggccatgaagagcagtgaattaatgcttgagctgggaggcattctacggact
ttcaagtttatcttcaggggtaccggatatgatgaaaaacttgtgcgggaagtggaaggc
cttgaggcttctggctcagtctacatttgtactctttgtgatgccacccgtctggaagcc
tctcaaaatcttgtcttccactctataaccagaagccatgctgagaacctggaacgttat
gaggtctggcgttccaatccttaccatgagtctgtggaagaactgcgggatcgggtgaaa
ggggtctcagccaaacctttcattgagacagtcccttccatagacgcactccactgtgac
attggcaatgcagctgagttctacaagatcttccagctagagataggggaggtgtataag
aatcccaatgcttccaaagaggaaaggaaaaggtggcaggccacactggacaagcatctc
cggaagaagatgaacctgaaaccaatcatgaggatgaatggcaactttgccaggaagctc
atgaccaaagagactgtggatgcagtttgtgagttaattccttcggaggagaggcacgag
gctctgagggagctgatggatctttacctgaagatgaaaccggtgtggcggtcatcatgc
cctgctaaagagtgcccagaatccctctgccagtacagtttcaattcacagcgttttgct
gagctcctttctaccaagttcaagtataggtatgagggaaaaatcaccaattattttcac
aaaaccctggcacatgttcctgaaattattgagagggatggctccattggggcatgggca
agtgagggaaatgagtctggtaacaaactgtttagacgcttccggaaaatgaatgccagg
cagtccaaatgctatgagatggaagacgtcctgaaacaccactggctgtacacctccaaa
tacctccagaagtttatgaatgctcataatgcattaaaaacctctgggtttaacatggac
tctcaggcaagcttaggggacccattaggcatagaggactctctggaaagccaagattca
atggaattttaa

DBGET integrated database retrieval system