KEGG   Macaca fascicularis (crab-eating macaque): 102129315
Entry
102129315         CDS       T02918                                 

Gene name
ORAI1
Definition
(RefSeq) ORAI calcium release-activated calcium modulator 1
  KO
K16056  calcium release-activated calcium channel protein 1
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04020  Calcium signaling pathway
mcf04024  cAMP signaling pathway
mcf04611  Platelet activation
mcf04924  Renin secretion
mcf04925  Aldosterone synthesis and secretion
mcf04927  Cortisol synthesis and secretion
mcf04934  Cushing syndrome
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102129315 (ORAI1)
   04024 cAMP signaling pathway
    102129315 (ORAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102129315 (ORAI1)
  09152 Endocrine system
   04924 Renin secretion
    102129315 (ORAI1)
   04925 Aldosterone synthesis and secretion
    102129315 (ORAI1)
   04927 Cortisol synthesis and secretion
    102129315 (ORAI1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102129315 (ORAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102129315 (ORAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcf04040]
    102129315 (ORAI1)
Ion channels [BR:mcf04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   102129315 (ORAI1)
SSDB
Motif
Pfam: Orai-1 m04gp34like YrhC
Other DBs
NCBI-GeneID: 102129315
NCBI-ProteinID: XP_005572515
Position
11
AA seq 198 aa
MVEVQLDADHDYPPGLLIAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKES
PHERMHRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAAN
VSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQ
DQLDHRGDHPLTPGSHYA
NT seq 597 nt   +upstreamnt  +downstreamnt
atggtggaggtgcagctggacgctgaccacgactacccgccagggctgctcatcgccttc
agtgcctgcaccacggtgctggtggctgtgcacctgtttgcactcatgatcagcacctgc
atcctgcccaacatcgaggcggtgagcaacgtgcacaacctcaactcggtcaaggagtcc
ccccacgagcgcatgcaccgccacatcgagctggcctgggccttctccaccgtcatcggc
acgctgcttttcctggccgaggtcgtgctgctctgctgggtcaagttcttgcccctcaag
aagcagccaggccagccgaggcccaccagcaagccccccgccagtggtgcagccgccaac
gtcagcaccagcggcatcaccccgggccaggcagccgccatcgcctcgaccaccatcatg
gtgcccttcggcctgatctttattgtcttcgccgtccacttctaccgctcactggtcagc
cataagacggaccgacagttccaggagctcaacgagctggcggagtttgctcgcttacag
gaccagctggaccacagaggggaccaccccctgacgcccggcagccactatgcctag

DBGET integrated database retrieval system