KEGG   Macaca fascicularis (crab-eating macaque): 102129731
Entry
102129731         CDS       T02918                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102129731 (AHRR)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102129731 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 102129731
NCBI-ProteinID: XP_015306654
Position
6
AA seq 697 aa
MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGVPSPRDSRPLAGSAVLEGRLLLESLN
GFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQV
VFGQPPPLETGDDAILGRLLRAQEWGAGAPTEYSAFLTRCFICRVRCLLDSTSGFLTMQF
QGKLKFLFGQKKKAPSGAVLPPRLSLFCIVAPVLLPSTAEMKMRSALLRAKPRADTVATT
DAKVKAATSLCESEPRGEPNYSAGRSSRESGVLVLREQTDAGRWAQVPTRAPCLCLRGSP
NLVLDPKGCSGDREEEQHKMLSRASGVTGHRETPGPTKPLPWTAGRHGEDGARPRLQPSK
SDLPCLRPTPRGSCLPYSCVQGTFRNSPISHPPSPSPSAYSSRTSRPVRNVGEDQVHPPL
CHFPQGSLQHRLPQPGAQRFATRGYPMEDVKLQGVPMPPGDLCGPTLLLDVPIKMEKDSG
SEDAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGTQPHGRA
TVGRSRELTPFHPAHCACLEPMHGLAQPEPPHQLCARGQGEQSCACRAAEATPVVKREPL
DSPPWATHSQGAVPGMFPKSALATLVPPQASECTFLP
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgatcccgccgggggagtgcacgtacgcgggccggaagcggaggaggcccctgcagaaa
cagaggcccgccgtgggggcagagaagtccaacccctccaagcggcaccgggaccgcctc
aacgccgagttggaccacctggccagcctgctgccgttcccacctgacatcatctccaag
ctggacaagctttctgtcctgcgtctcagtgtcagttacctccgggtgaagagcttcttc
caagtcgtgcaggagcagagctcacggcagccggcggccggtgtcccctcgcccagagat
agccgtcctcttgcagggtctgccgtgctggagggaaggctgctgctggagtctcttaat
ggctttgctctggtcgtgagtgcagaagggacgatattttatgcgtcagcaacgatcgtg
gactatctgggcttccatcagacagacgtcatgcaccagaacatttacgactacatccac
gtggacgaccgccaggacttctgccggcagctccactgggccatggaccctccccaggtg
gtgtttgggcagcccccgcccttggagacaggagatgacgccatcctggggaggcttctc
agggcccaggagtggggagcaggcgcgcccaccgagtactcagccttcctgacccgctgc
ttcatctgccgtgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagttt
caaggaaaactgaaattcctgtttggacagaagaagaaggcaccgtcgggagccgtgctc
cccccgcgactgtcgctgttctgcatcgtggcgcccgttctcctcccctccacagcggag
atgaaaatgaggagtgcacttctgagggcaaagcccagggcagacaccgtagccaccaca
gatgcaaaagtaaaagccgccaccagtctgtgcgaatcggaaccgcgtggagaacccaat
tactcagcaggaaggagcagcagagaaagcggcgttttggtgctcagggaacagactgac
gctggccgatgggcacaggttcccaccagggctccgtgcctgtgcctccggggcagcccc
aaccttgtcctcgaccccaaggggtgctcaggggacagggaggaggagcagcacaagatg
ctgagcagggcctccggagtgacagggcacagggagactccaggacccacgaagcccctg
ccctggacagcgggaaggcatggtgaggatggtgccaggccgaggctgcagcccagcaag
agtgacctaccctgcctgcgccccacgccccgcggctcctgcctgccctactcgtgtgtc
cagggcactttcaggaactcgcccatctctcacccgccgagcccatcccccagtgcctac
tccagccggaccagcagacctgtgcggaatgtcggtgaggaccaggtgcaccctcccctc
tgccactttccccaggggagcctgcagcaccggctccctcagcctggagctcagcgtttt
gccacgaggggctatcccatggaggacgtgaagctgcagggtgtgccgatgcctccgggg
gacctgtgcggtccgacgctgctgctagatgtgcccatcaagatggagaaggactctggg
tctgaggatgctgcagacggctgtgtgcccagccaggtgtggctgggggccagtgacagg
agccatccagccaccttccctaccaggatgcacctgaaaacagagccagactctcggcaa
caggtgtacatctcgcacctggggcacggcgtgcgggggactcagcctcatggcagggcc
actgttgggcgcagcagggagctgacccctttccaccctgcacactgtgcctgcctggag
cccatgcacggccttgcccagccagaacctccccaccagctctgtgcacggggccaaggc
gaacagtcctgcgcctgcagagctgctgaggccacccctgtggtcaagcgggagcccctg
gactcacccccgtgggctactcacagccagggagcggtgcctgggatgtttcccaaaagt
gccttggcaacgctggtcccgccccaagcttcggagtgcacgttcctcccgtag

DBGET integrated database retrieval system