KEGG   Macaca fascicularis (crab-eating macaque): 102129952Help
Entry
102129952         CDS       T02918                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP] cytoplasmic-like
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00020  Citrate cycle (TCA cycle)
mcf00480  Glutathione metabolism
mcf01100  Metabolic pathways
mcf01200  Carbon metabolism
mcf01210  2-Oxocarboxylic acid metabolism
mcf01230  Biosynthesis of amino acids
mcf04146  Peroxisome
Module
mcf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102129952
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102129952
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102129952
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     102129952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh zf-C2H2_assoc
Motif
Other DBs
NCBI-GeneID: 102129952
NCBI-ProteinID: XP_015304399
Position
4
AA seq 685 aa AA seqDB search
MAGSQPPHKQPMISIGGGEKYMHGGKCISQVKLKAAGEVSVGCGGEGKYPWDVEERGEIS
MECGGGREVTIALLPPQGGGVAQSGSIQQASPVPSAPPQAEPLGSARVARLPVHFCSVQI
SEKFALTGVSSVKPGYVRTINRKQNAGHEKEDFLLAVPFVKTFVKMKMLNQKRPDSGEAG
EKAAKSGEYPQPSTLDYLSIAFLQTPEEPFYQLFCKCKFLVVPETHLFIKVKIYLKISGS
SVVEIQGDEMTQIIWELIQEKLIFPYVELDLHSYDLGIENRDTTNHQVTTDAAEAIKKYN
IGVKCATVIPDEKRVEEFKLKQMWKSLNGTIQNIILGGTVFRKVIICKNIRQLMSGWVKP
TIVGRHAYGDQYRATYFIVPGPGKVELTYTLSDSTQKVTYLVHNLEEDDSVAMGMYNQDK
SIKDFAHSSFQMXSKGWPLYLSTXNTILKKYDERFKDIFXEIYDKQYKSQFEAQKILYEH
RLIDDMVVQAMKSEGGFIWASKKYTGDMQSDSVVQGYVSLGMMTSVLVCPQGKTVEAVAA
HWTVTCHYRMSQKGQETSINPIASIFACTRGLALRAKIDNDKELGFFANALEEVCIETTE
AGFMTEDLAASIKGLPSVQCSDYLNMFEFMDKLGENLKIKLAQAKLEIHTWAEEVYNEGH
DPPVGIDTVEELFAFTDMSRLGKEK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctggaagtcagcctccgcacaaacagcccatgatatccattggtggaggagagaag
tacatgcatggagggaagtgcataagccaagtgaaattgaaggcggcaggggaggtctcc
gtgggatgtggaggggaagggaagtatccatgggacgtggaggagagaggggagatctcc
atggagtgtggagggggaagggaggtgaccatagctctgcttcctccacagggaggggga
gtggcccagtctggctccatccagcaggcttcacctgtgccctcggccccaccacaggca
gagccgttgggctctgcccgtgttgctagacttccagttcacttttgttcagttcagatc
tcagagaaatttgcactgacaggggtgagttcagtcaaacctggctatgtgcgaactatc
aaccggaaacagaatgctggccatgaaaaggaggactttctcctcgctgtgccctttgtt
aaaacttttgtgaaaatgaagatgctaaaccagaagaggccagactctggtgaagcagga
gagaaagcagccaaatctggtgagtatcctcaaccgagtaccctcgattatctcagcatt
gccttcttgcagacaccagaagagccattttaccaactattttgtaaatgcaagttttta
gtagttccagaaacacacttgtttattaaagtcaaaatatatttaaaaatcagtggcagt
tctgtggtagagattcaaggagatgaaatgacacaaatcatttgggaattgattcaagag
aaactcatttttccctatgtggaactggatctacatagctatgatttaggcatagagaat
cgtgataccaccaaccaccaggtcaccacggatgctgcagaagctataaaaaagtataac
attggtgtcaagtgtgccaccgtcatccctgatgagaaaagggttgaggagttcaagttg
aaacaaatgtggaaatcgctaaatggcaccatccaaaatattattctgggtggcacagtc
ttcagaaaagtcattatctgcaaaaatatccgccagcttatgagtggatgggtaaaaccc
accatcgtaggtcgtcatgcttatggggatcaatacagagcaacttattttattgttcct
gggcctggaaaagtagagctaacctacacactaagtgacagcacccaaaaggtgacatac
ctggtacataacttggaagaggatgatagtgttgccatggggatgtataaccaagataag
tcaattaaagattttgcacacagttccttccaaatgngctctaagggttggcctttgtat
ctgagcactnaaaacactattttgaagaaatatgatgaacgttttaaagacatcttttag
gagatatatgacaagcagtacaagtcccaatttgaagcccaaaagatcttgtatgagcat
aggctcatcgatgacatggtggtccaagctatgaaatcagaaggaggcttcatctgggcc
tctaaaaagtatactggtgacatgcagtcagactctgtggttcaagggtatgtctctctt
ggcatgatgaccagtgtgctggtgtgtccgcaaggtaagacagtagaagcagtggctgcc
cactggactgtaacctgtcactaccgcatgtcccagaaaggccaggagacgtccatcaat
cccattgcttctatttttgcctgtaccagagggttggccctcagagcaaagattgataac
gataaagagcttggcttctttgcaaatgctttggaagaagtctgtattgagacaactgag
gctggtttcatgaccgaggacttggctgctagcattaaaggtttacccagtgtgcaatgt
tctgactacttgaatatgtttgagttcatggacaaacttggagaaaacttgaagatcaaa
ctggctcaggccaaacttgaaattcatacctgggctgaggaggtatataatgaaggccat
gacccaccagtgggaattgacactgtggaagagctatttgccttcacggatatgagcaga
ctaggaaaagaaaaatga

DBGET integrated database retrieval system