KEGG   Macaca fascicularis (crab-eating macaque): 102130757
Entry
102130757         CDS       T02918                                 

Gene name
ALB
Definition
(RefSeq) albumin
  KO
K16141  serum albumin
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102130757 (ALB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102130757 (ALB)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   102130757 (ALB)
SSDB
Motif
Pfam: Serum_albumin VitD-bind_III
Other DBs
NCBI-GeneID: 102130757
NCBI-ProteinID: NP_001306284
UniProt: A2V9Z4
Position
5
AA seq 608 aa
MKWVTFISLLFLFSSAYSRGVFRRDTHKSEVAHRFKDLGEEHFKGLVLVAFSQYLQQCPF
EEHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEP
ERNECFLQHKDDNPNLPPLVRPEVDVMCTAFHDNEATFLKKYLYEVARRHPYFYAPELLF
FAARYKAAFAECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGDRAFKAWAV
ARLSQKFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYMCENQDSISSKLK
ECCDKPLLEKSHCLAEVENDEMPADLPSLAADYVESKDVCKNYAEAKDVFLGMFLYEYAR
RHPDYSVMLLLRLAKAYEATLEKCCAAADPHECYAKVFDEFQPLVEEPQNLVKQNCELFE
QLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGAKCCKLPEAKRMPCAEDYLSVV
LNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALELDEAYVPKAFNAETFTFHADMCTL
SEKEKQVKKQTALVELVKHKPKATKEQLKGVMDNFAAFVEKCCKADDKEACFAEEGPKFV
AASQAALA
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgaagtgggtaacctttatttcccttctctttctctttagctcagcttattccaggggt
gtgtttcgtcgagatacacacaagagtgaggttgctcatcggtttaaagatttgggagaa
gaacatttcaaaggcttggtgctggttgctttttctcagtatcttcagcagtgtccattt
gaagagcatgtaaaattagtgaatgaagtaactgaatttgcaaaaacatgtgttgctgat
gagtcagctgaaaattgtgacaaatcacttcatactctttttggagacaaattatgcaca
gtcgcaactcttcgtgaaacctatggtgaaatggctgactgctgtgcaaaacaagaacct
gagagaaatgaatgcttcctgcaacacaaagatgacaacccgaacctccccccattggtg
agaccagaggttgatgtgatgtgcactgcttttcatgataatgaagcgacatttttgaaa
aaatacttatatgaagttgccagaagacatccttacttttatgccccagaactccttttc
tttgctgcaaggtataaagctgcttttgcagaatgttgtcaagctgctgataaagctgcc
tgcctcttaccaaagcttgatgaacttcgggatgaagggaaggcttcatctgccaaacag
agactcaagtgtgccagtctccaaaaattcggagacagagctttcaaagcatgggcagta
gctcgcttgagccagaaatttcccaaagctgagtttgcagaagtttccaagttagtgaca
gatcttaccaaagtccacacggaatgctgccatggagatctgcttgaatgtgctgatgac
agggcggaccttgccaagtatatgtgtgaaaatcaagattcaatctccagtaaactgaag
gaatgctgtgataaacctctgttggaaaaatcccactgccttgccgaagtggaaaatgat
gagatgcctgctgacttgccttcattagctgctgattatgttgagagtaaggatgtttgc
aaaaactatgctgaggcaaaggatgtcttcctgggcatgtttttgtatgaatatgcaaga
aggcatcctgattactctgtcatgctgctgctgagacttgccaaggcatacgaagccact
ctagagaagtgctgtgccgctgcagatcctcatgaatgctatgccaaagtgtttgatgag
tttcaacctcttgtggaagagcctcagaatttagtcaaacaaaattgtgaactttttgag
cagcttggagaatacaaattccagaatgcgctattagttcgttacaccaagaaagtaccc
caagtgtcaactccaactcttgtagaggtctcaagaaacctaggaaaagtgggtgccaaa
tgttgtaaacttcctgaagcaaaaagaatgccctgtgcagaagactatctgtccgtggtc
ctgaaccggttatgtgtgttgcatgagaaaacgccagtaagcgagaaagtcaccaaatgc
tgcacggaatccttggtgaacaggcgaccatgcttttctgctctggaactcgatgaagca
tatgttcccaaagcgtttaatgctgaaacattcaccttccatgcagatatgtgcacactt
tctgagaaggagaaacaagtcaagaaacaaactgcacttgttgagctcgtgaaacacaag
cctaaggcaacaaaagagcaactgaaaggtgttatggataatttcgcagcttttgtagag
aagtgctgcaaggctgatgataaggaggcctgctttgccgaggagggtccaaaatttgtt
gctgcaagtcaagctgccttagcctaa

DBGET integrated database retrieval system