KEGG   Macaca fascicularis (crab-eating macaque): 102132844Help
Entry
102132844         CDS       T02918                                 

Gene name
KCNJ2
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 2
  KO
K04996  potassium inwardly-rectifying channel subfamily J member 2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04725  Cholinergic synapse
mcf04921  Oxytocin signaling pathway
mcf04924  Renin secretion
mcf04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    102132844 (KCNJ2)
   04924 Renin secretion
    102132844 (KCNJ2)
  Digestive system
   04971 Gastric acid secretion
    102132844 (KCNJ2)
  Nervous system
   04725 Cholinergic synapse
    102132844 (KCNJ2)
Ion channels [BR:mcf04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (KCNJ)
   102132844 (KCNJ2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK IRK_N Ion_trans_2 Ion_trans
Motif
Other DBs
NCBI-GeneID: 102132844
NCBI-ProteinID: XP_005584868
UniProt: G7PVA0
Position
16
AA seq 427 aa AA seqDB search
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtgtgcgaaccaaccgctacagcattgtctcttcagaagaagacggtatgaag
ttggccaccatggcagttgcaaatggctttgggaacgggaagagtaaagtccacacccga
caacagtgcaggagccgctttgtgaagaaagatggtcactgtaacgttcagttcatcaat
gtgggtgagaaggggcaacggtacctcgcagacatcttcaccacgtgtgtggacattcgc
tggcggtggatgctggttatcttctgcctggctttcgtcctgtcatggctgttttttggc
tgtgtgttttggttgatagctctgctccatggggacctggatgcatccaaagagggcaaa
gcttgtgtgtccgaagtcaacagcttcacggctgccttcctcttctccattgagacccag
acaaccataggctatggtttcaggtgtgtcacggatgaatgcccaattgctgttttcatg
gtggtgttccagtcaatcgtgggctgcatcattgatgctttcatcattggtgcagtcatg
gccaagatggcaaagccaaagaagagaaacgagactctcgtcttcagtcacaatgctgtg
attgccatgagagatggcaagctgtgtttgatgtggcgagtgggcaatcttcggaaaagc
cacttggtggaagctcatgtccgagcacagctcctcaaatccagaatcacttctgaaggg
gagtatatccctctggatcaaatagacatcaatgttgggtttgacagtggaatcgatcgt
atatttctggtgtccccaatcactatagtccatgaaatagacgaagacagtcctttatat
gatttgagtaaacaggacattgacaatgcagactttgaaatcgtggtcatactggaaggc
atggtggaagccactgccatgacgacacagtgccgtagctcttatctagcaaatgaaatc
ctgtggggccaccgctatgagcctgtgctctttgaagagaagcactactacaaagtggac
tattccaggttccacaaaacttacgaagtccccaacactcccctttgcagtgcaagagac
ttagcagaaaagaaatacatcctctcaaatgcgaattcattttgctatgaaaatgaagtt
gccctcacaagcaaagaggaagatgacagtgaaaacggagttccagaaagcactagtacg
gacacgccccctgacatagaccttcacaaccaggcaagtgtacctctagagcccaggccc
ttacggcgagagtcggagatatga

DBGET integrated database retrieval system