KEGG   Macaca fascicularis (crab-eating macaque): 102133003Help
Entry
102133003         CDS       T02918                                 

Gene name
NKX2-2, NKX2B
Definition
(RefSeq) NK2 homeobox 2
  KO
K08029  homeobox protein Nkx-2.2
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    102133003 (NKX2-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    102133003 (NKX2-2)
Transcription factors [BR:mcf03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    102133003 (NKX2-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 102133003
NCBI-ProteinID: XP_015313223
UniProt: G7PH38
Position
10
AA seq 273 aa AA seqDB search
MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLP
LKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPG
GGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHR
YKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQ
SLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgaccaacacaaagacggggttttcggtcaaggacatcttagacctgccggac
accaacgatgaggagggctctgtggccgaagggccggaggaagagaacgaggggcccgag
ccagccaagagggccgggccgctggggcagggcgccctggacgcggtgcagagcctgccc
ctgaagaaccccttctacgacagcagcgacaacccgtacacgcgctggctggccagcacc
gagggcctccagtactccctgcacggtctggcggcaggcgcgccccctcaggactcaagc
tccaagtccccggagccctcggccgacgagtcaccggacaatgacaaggagaccccgggc
ggcgggggggacgctggcaagaagcggaagcggcgggtgcttttctccaaggcgcagacc
tacgagctggagcggcgctttcggcagcagcggtacctgtcggcgccggagcgcgagcac
ctggccagcctcattcgcctcacgcccacgcaggtcaagatctggttccagaaccaccgc
tacaagatgaagcgcgcccgggccgagaaaggtatggaggtgacgcccctgccctcgccg
cgccgggtggctgtgcccgtcttggtcagggacggcaaaccgtgccacgcgctcaaagcc
caggacctggcagccgccaccttccaggcgggcattcccttttcggcctacagcgcgcag
tcgctgcagcacatgcagtacaacgcccagtacagctcggccagcaccccccagtacccg
acagcacaccccctggtccaggcccagcagtggacttggtga

DBGET integrated database retrieval system