KEGG   Macaca fascicularis (crab-eating macaque): 102133523Help
Entry
102133523         CDS       T02918                                 

Gene name
AURKC
Definition
(RefSeq) aurora kinase C
  KO
K11480  aurora kinase C [EC:2.7.11.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102133523 (AURKC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcf03036]
    102133523 (AURKC)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102133523 (AURKC)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   102133523 (AURKC)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102133523 (AURKC)
  Sister chromatid separation proteins
   Aurora kinases
    102133523 (AURKC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 102133523
NCBI-ProteinID: XP_005590555
Position
19
AA seq 471 aa AA seqDB search
MRTPWVYALFMLSGPLPSPPRRTLCLLPSRASPLGLAFRAQPRPARSSSAPTRGPWAESP
ISVFSIGRTSDGVRNFSQWESARKYLSERAAPGIKEGRAATALHEAADTGACVCLGPREA
AGRAGLEAHQPESDPQPLSGRCEREQPSRGLRKASAPSPLLPMSSPKAAVQLGRAQPAGE
AVTAANQTAQQPSSPAMRRLKIDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQ
IEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEFAPRGELYKELQKSEKL
DEQRTATIIEELADALTYCHEKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKT
MCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESTSHSETYRRILKVDVRF
PLSMPLGARDLISKLLRYQPLERLPLAQILKHPWVQVHSRRVLPPCAQMAS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccccgtgggtgtatgcattgttcatgctctctggcccgctcccatcaccgcct
cgccgcaccctctgcctccttccttctcgggcctcacccctgggcctcgctttcagggcc
cagccccggcctgcgcgctccagttccgccccgacccgggggccctgggcggagagtccc
atttctgtcttttctattgggcgcacttccgatggcgtcaggaatttcagccaatgggag
tcagccaggaagtacctctctgagcgggcagcgccgggtataaaagaaggccgcgcagcc
acggctcttcacgaggccgcggataccggggcttgtgtgtgtttgggacctcgagaggcc
gcaggacgagcaggattggaagcgcatcagccagaaagtgacccccaacccctttcagga
cgctgtgaaagggaacagccatccagagggctcaggaaggcgtccgcgccgtcacctctt
ctccccatgagctcccccaaagctgcggtgcagctgggcagagctcagcctgcaggcgaa
gcggtgactgcagcaaaccaaacagcccagcagcccagcagcccagccatgcggcgcctc
aaaatcgatgactttgaaatcgggcgtcccctgggcaaggggaaatttgggaatgtgtac
ctggctcggctcaaggaaagccatttcattgtggccctgaaggttctcttcaagtcgcag
atagagaaggaagggctggagcaccagctgcgccgggaaattgagatccaggcgcatcta
caacaccccaatatcctgcgcctgtataactatttccatgatgcacgccgggtgtacctg
attctggaatttgctccgaggggagagctctacaaggagctgcagaaaagcgagaaatta
gatgaacagcgcacagccacgataatagaggagttggcagatgccctgacctactgccat
gagaagaaagtgattcacagagacattaagccagagaacctgctgctggggttcaggggt
gaggtgaagattgcagattttggctggtctgtgcacaccccctccctgaggagaaagacg
atgtgtgggacactggactacttgcccccagaaatgattgaggggagaacatatgatgaa
aaggtggatttgtggtgcattggagtgctctgctatgagctgctggtgggatatccaccc
tttgagagcacctcccacagcgagacttacagacgcatcctcaaggtagatgtgaggttt
ccactatcaatgcctttgggggcccgggacttgatttccaagcttctcagataccagccc
ttggagcgactgcccctggcccagatcctgaagcacccctgggttcaggtccactcccga
agggtgctgcctccctgtgctcagatggcttcctga

DBGET integrated database retrieval system