KEGG   Macaca fascicularis (crab-eating macaque): 102134669
Entry
102134669         CDS       T02918                                 

Gene name
JAK3
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04062  Chemokine signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04217  Necroptosis
mcf04550  Signaling pathways regulating pluripotency of stem cells
mcf04630  JAK-STAT signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf05161  Hepatitis B
mcf05162  Measles
mcf05166  Human T-cell leukemia virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05223  Non-small cell lung cancer
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102134669 (JAK3)
   04151 PI3K-Akt signaling pathway
    102134669 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102134669 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102134669 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102134669 (JAK3)
   04659 Th17 cell differentiation
    102134669 (JAK3)
   04062 Chemokine signaling pathway
    102134669 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102134669 (JAK3)
   05203 Viral carcinogenesis
    102134669 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102134669 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102134669 (JAK3)
   05161 Hepatitis B
    102134669 (JAK3)
   05162 Measles
    102134669 (JAK3)
   05169 Epstein-Barr virus infection
    102134669 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    102134669 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102134669 (JAK3)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102134669 (JAK3)
Protein kinases [BR:mcf01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102134669 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo ABC1 Kinase-like APH SH2 LRR_RI_capping Haspin_kinase
Other DBs
NCBI-GeneID: 102134669
NCBI-ProteinID: XP_005588454
Position
19
AA seq 1167 aa
MTVAQETKGPTQEGAEWDFPLAASRLCSPFEGPGSLPARQVALMAPPSEETPLIPQRSCS
LLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKASGILPVYHSLFALATED
LSYWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLDKCHRFGLRKDLASAILDLPVLEHL
FAQHRGDLVSGRLAVGLSLKEQGECLSLAVLDLARMAREQAQRPGELLKTVSYKACLPPS
LRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIMDLERLDPAGAAETFHVS
LPGVPGGQDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRL
VTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFCKEVAPPRLLEEVAEQCH
GPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQTPLGPDYKGCLIRRSPTGS
FFLVGLSRSHSSLRELLAACWDGGLHVDGVTVTLTSCCIPRPKEKSNLIVVQRGRSPPTS
SLVQPQSQCQLSQMIFHKIPADSLEWHENLGHGSFTKIYRGCRHEVVDGESRKTEVLLKV
MDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQEFVHLGAIDTYLRKRGH
LVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGTDGSPPFIKLSDPGVSPA
VLSLEMLTDRIPWVAPECLRKAQTLSLEADKWGFGATVWEVFSGVTMPISALDPAKKLQF
YEDRQQLPAPKWTELAMLIQQCMAYEPVQRPSFRAVIRDLNSLISSDYELLSDPTPGALA
PRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQL
QHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRH
RARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLD
KDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRM
MGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSTLGPQLDM
LWSGSRGCETHAFTAHPEGKPHSLSFL
NT seq 3504 nt   +upstreamnt  +downstreamnt
atgacagtggctcaggaaaccaaggggcccacacaggaaggagccgagtgggactttcct
ctcgctgcctcccggctctgctctcccttcgaaggtccagggtccctgcctgctaggcaa
gttgcactcatggcacctccgagtgaggagacacccctgatccctcagcgctcctgcagc
ctcttgtccacggaggctggtgccctgcacgtgctactgcccgctcggggcccggggccc
ccccagcgcctatctttctcctttggggaccacttggctgaggacctgtgcgtgcaggct
gccaaggccagcggcatcctgcctgtgtaccactccctctttgctctggccacggaggac
ctgtcctactggttccccccgagccacatcttctccgtggaggatgccagcacccaagtc
ctgctctacaggattcgtttttacttccccaattggtttgggctggacaagtgccaccgc
ttcgggctacgcaaggatttggccagcgctatccttgacctgccagtcctggagcacctc
tttgcccagcaccgcggtgacctggtgagtgggcgccttgctgtgggcctcagcctcaag
gagcagggtgagtgtctcagcctggccgtgctggacctggcccggatggcgcgagagcag
gcccagcggccaggagagctgctgaagactgtcagctacaaggcctgcctgcccccaagc
ctgcgcgacctgatccagggcctgagcttcgtgacgcggaggcgtattcggaggacagtg
cgcagagccctgcgccgcgtggccgcctgccaggccgaccggcactcgctcatggccaag
tacattatggatctggagcggctggatccggctggggccgccgagaccttccacgtgagc
ctccctggggtccctggtggccaggacgggctggggctgctccgcgtggctggtgacgga
ggaatcgcctggacccagggagaacaggaggtcctccagcccttctgcgactttccagaa
atcgtagacattagcatcaagcaggccccgcgcgttggcccggccggggagcaccgcctg
gtcactgtcaccaggacagacaaccagattttggaggccgagttcccggggctgcccgag
gctctgtctttcgtggcgctcgtggacggctacttccggctgaccacagactcccagcac
ttcttctgcaaggaggtggcaccgccgaggctgctggaggaggtggcagagcagtgccac
ggccccatcactctggactttgccataaacaagcttaagactgggggctcacgtcctggc
tcctatgttctccgccgcagcccccaggactttgacagcttcctcctcactgtctgtgta
cagaccccccttggtcctgattataagggttgcctcattcggcgcagccccacagggagc
ttctttctggttggcctcagccgatcccacagcagtcttcgagagctcctggcagcctgc
tgggatggggggctgcacgtagatggggtcacagtgaccctcacctcctgctgtatcccc
agacccaaagaaaagtccaacttgatcgtggtccagagaggtcgcagcccacccacgtcc
tccctggttcagccccaatcccaatgccagctgagtcagatgatatttcacaagatcccc
gctgacagcctagagtggcatgagaacctgggccatggatccttcaccaagatttaccgg
ggctgtcgccacgaggtggtggatggggagtcccgaaagacagaggtgctgctaaaagtg
atggatgctaagcacaagaactgcatggagtcattcctggaagcagcgagcttgatgagc
caagtgtcgtaccggcatctcgtgctgctccacggcgtgtgcatggctggagacagcacc
atggtgcaagaatttgtacacctgggggcgatagacacgtatctgcgaaaacgtggccac
ctggtgccagccagctggaagctgcaggtggtcaaacagctggcctacgccctcaactat
ctggaggacaaaggcctcccccatggcaatgtctccgcccggaaggtgctcctggctcgg
gagggcactgatgggagcccgcccttcatcaagctaagtgaccctggggtcagccccgct
gtgttaagcctggagatgctcaccgacaggatcccctgggtggctcccgagtgtcttcgg
aaggcccagacacttagcttggaagctgacaagtggggctttggcgccacggtctgggag
gtgtttagtggcgtcaccatgcccatcagcgccctggatcctgctaagaaactccaattt
tatgaggaccggcagcagctgccagcccccaagtggacagagctggccatgctaattcaa
cagtgcatggcctatgagccagtccagaggccctccttccgagccgtcattcgtgacctc
aacagcctcatctcttcagactatgagctcctctcagaccccacacctggtgccctggca
cctcgtgatgggctgtggaatggtgcccagctctatgcctgccaagaccccacgatcttc
gaggagagacacctcaagtacatctcacagctgggcaagggcaactttggcagcgtggag
ctgtgccgctatgacccgctaggcgacaacacaggtgccctggtggccgtgaaacagctg
cagcacagcgggccagaccagcagagggacttccagcgggagattcagatcctcaaagca
ctgcacagtgatttcattgtcaagtatcgtggtgtcagctacggcccgggccgccagagc
ctgcggctggtcatggagtacctgcccagcggctgcttgcgcgacttcctgcagcggcac
cgcgcgcgcctggatgccagccgcctcctgctctactcctcgcagatctgcaagggcatg
gagtacctgggctcccgccgctgcgtgcaccgcgacctggccgcccgaaatatcctggtg
gagagcgaggcacacgtcaagatcgctgacttcggcctagctaagctgctgccgcttgac
aaagactactacgtggtccgcgagccgggccagagccccattttctggtatgcccccgaa
tccctctcggacaacatcttctctcgccagtcagacgtctggagcttcggggtcgtcctg
tacgagctcttcacctactgcgacaaaagctgcagcccctcggccgagtttctgcggatg
atgggatgtgagcgggatgtccccgccctctgccgcctcctggaactgctggaggagggc
cagaggctgccggcgcctcctgcctgccctgctgaggttcacgagctcatgaagctgtgc
tgggcccctagcccacaggaccgcccatcattcagcaccctgggcccccagctggacatg
ctatggagcggaagccgggggtgtgagactcacgccttcactgctcacccagagggcaaa
ccacactccctgtcctttttatag

DBGET integrated database retrieval system