KEGG   Macaca fascicularis (crab-eating macaque): 102135442
Entry
102135442         CDS       T02918                                 

Gene name
ZAP70
Definition
(RefSeq) tyrosine-protein kinase ZAP-70
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04014  Ras signaling pathway
mcf04064  NF-kappa B signaling pathway
mcf04650  Natural killer cell mediated cytotoxicity
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf05135  Yersinia infection
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102135442 (ZAP70)
   04064 NF-kappa B signaling pathway
    102135442 (ZAP70)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102135442 (ZAP70)
   04660 T cell receptor signaling pathway
    102135442 (ZAP70)
   04658 Th1 and Th2 cell differentiation
    102135442 (ZAP70)
   04659 Th17 cell differentiation
    102135442 (ZAP70)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102135442 (ZAP70)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102135442 (ZAP70)
  09163 Immune disease
   05340 Primary immunodeficiency
    102135442 (ZAP70)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102135442 (ZAP70)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102135442 (ZAP70)
Protein kinases [BR:mcf01001]
 Non-receptor tyrosine kinases
  SYK family
   102135442 (ZAP70)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 ABC1 Kdo Haspin_kinase
Other DBs
NCBI-GeneID: 102135442
NCBI-ProteinID: XP_005575086
UniProt: A0A2K5WL69
Position
13
AA seq 619 aa
MPDPAAHLPFFYGSISRSEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
TQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASSASGAAAPTLPAHPSTFTHPQRRIDTLNSDGYTPEPARVT
SPEKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGSG
PLHKFLAGKKEEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY
KKMKGPEVMAFIEQGKRMECPSECPPELYELMSDCWIYKWEDRPDFLTVEQRMRACYYSL
ASKAEGSPGCAQKAEAACA
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgccagaccccgcggcgcacctgcccttcttctacggcagcatctcgcgctccgaggcc
gaggagcacctgaagctggcgggcatggcggacgggctcttcctgctgcgccagtgcctg
cgctcgctgggcggctatgtgctgtcgctcgtgcacgacgtgcgcttccaccactttccc
atcgagcgccagctcaacggcacctacgccatcgcgggcggcaaggctcactgcggaccg
gccgagctctgcgagttctactcgcgcgaccccgacgggctgccctgcaacctgcgtaag
ccgtgcaaccgaccgtcgggcctggagccgcagccgggcgtcttcgactgcctgcgcgac
gccatggtgcgcgactacgtgcgccagacctggaagctggagggcgaggccctggagcag
gccatcatcagccaggcaccgcaggtggagaaacttattgctacgacggcccacgagcgg
atgccctggtaccacagcagcctcacgcgtgaggaggccgagcgcaaactttactctggg
acccagaccgacggcaagttcctgctgaggccgcggaaggagcagggcacgtatgccctg
tccctcatctatgggaagacggtgtaccactacctcatcagccaagacaaggcgggcaag
tactgcattcccgagggcaccaagtttgacacgctctggcagctggtggagtatctgaag
ctgaaggcggatgggctcatctactgcctgaaggaggcctgtcccaacagcagcgccagc
agcgcctcaggggctgctgctcccacgctcccagcccacccatccacgttcactcaccct
cagagacggatcgacaccctcaactcagatggatacacccctgagccagcgcgcgtaacg
tccccggagaaaccgcggccgatgcccatggacaccagcgtgtatgagagcccctacagc
gacccagaggagctcaaggacaagaagctcttcctgaagcgcgataacctcctcatagcc
gacattgaacttggctgcggcaactttggctcagtgcgccagggcgtgtaccgcatgcgc
aagaagcagattgacgtggccatcaaggtgctgaagcagggcacggagaaggcggacacg
gaggagatgatgcgggaggcacagatcatgcaccagctggacaacccctacatcgtgcgg
ctcattggcgtctgccaggctgaggccctcatgctcgtcatggagatggctggcagcggg
ccgctgcacaagttcctggctggcaagaaggaggagatccccgtgagcaatgtggccgag
ctgctgcaccaggtgtccatggggatgaagtacctggaggagaagaacttcgtgcaccgt
gacctggcggcccgcaacgtgctgctggttaaccggcactacgccaagatcagcgatttc
ggcctctccaaagcactgggcgccgatgacagttattacactgcccgctcagcagggaag
tggccgctcaagtggtacgcacccgagtgcatcaacttccgcaagttctccagccgcagc
gatgtctggagctacggggtcaccatgtgggaggccttgtcctacggccagaagccctac
aagaagatgaaagggccggaggtcatggccttcatcgagcagggcaagcggatggagtgc
ccatcagagtgtccgcctgaactgtacgaactcatgagcgactgctggatctacaagtgg
gaggatcgccccgacttcctgaccgtggagcagcgcatgcgggcctgttactacagcctg
gccagcaaagcggagggctccccgggctgcgcgcagaaggccgaggctgcctgtgcctga

DBGET integrated database retrieval system