KEGG   Macaca fascicularis (crab-eating macaque): 102135743Help
Entry
102135743         CDS       T02918                                 

Gene name
KDM1A
Definition
(RefSeq) lysine demethylase 1A
  KO
K11450  [histone H3]-N6,N6-dimethyl-L-lysine4 FAD-dependent demethylase [EC:1.14.99.66]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102135743 (KDM1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcf03036]
    102135743 (KDM1A)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.66  [histone H3]-N6,N6-dimethyl-L-lysine4 FAD-dependent demethylase
     102135743 (KDM1A)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    102135743 (KDM1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase SWIRM NAD_binding_8 DAO Pyr_redox_2 AlaDh_PNT_C Pyr_redox FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 GIDA 2-Hacid_dh_C DUF1917 Lycopene_cycl MutS_IV Pyr_redox_3 MRPL52
Motif
Other DBs
NCBI-GeneID: 102135743
NCBI-ProteinID: XP_005544550
UniProt: A0A2K5TKZ2
Position
1
AA seq 852 aa AA seqDB search
MLSGKKAAAAAAAAAAAAAGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAAGERTP
RKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEY
REMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQ
SRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEA
PYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSF
GMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKC
PLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLV
KSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFAN
ATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGC
EVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLN
KVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISD
DVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPI
TPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQA
TPGVPAQQSPSM
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctgggaagaaggcggcagccgcggcggcggcggctgcagcggcggcagccggg
acggaggctggccccgggacagcgggcggctctgagaatgggtctgaggtggccgcgcaa
cccgcgggcctgtcgggcccagccgaggtcgggccgggggcggccggggagcgcacaccc
cgcaagaaagagcctccgcgggcctcgccccccgggggcctggccgaaccgccagggtcc
gcagggcctcaggccgggcccaccgtcgtgcctgggtctgcgacccccatggaaactgga
atagcagagactccggaggggcgtcggaccagccggcgcaagcgggcgaaggtagagtac
agagagatggatgaaagcttggccaacctctcagaagatgagtattattcagaagaagag
agaaatgccaaagcagagaaggaaaagaaacttcccccaccaccccctcaagccccacct
gaggaagaaaatgaaagtgagcctgaagaaccatcgggtgtggagggcgcagctttccag
agccgacttcctcatgaccggatgacttctcaagaagcagcctgttttccagatattatc
agtggaccacaacagacccagaaggtttttctgttcattagaaaccgcacactgcagttg
tggttggataatccaaagattcagctgacatttgaggctactctccaacaattagaagca
ccttataacagtgatactgtgcttgtccaccgagttcacagttatttagagcgtcatggt
cttatcaacttcggcatctataagaggataaaacccctaccaactaaaaagacaggaaag
gtaattattataggctctggggtctcaggcttggcagcagctcgtcagttacaaagtttt
ggaatggatgtcacacttttggaagccagggatcgtgtgggtggacgagttgccacattt
cgcaaaggaaactatgtagctgatcttggagccatggtggtaacaggtcttggagggaat
cctatggctgtggtcagcaaacaagtaaatatggaactggccaagatcaagcaaaaatgc
ccactttatgaagccaacggacaagctgttcctaaagagaaagatgaaatggtagagcaa
gagtttaaccggttgctagaagctacatcttaccttagtcatcaactagacttcaatgtc
ctcaataataagcctgtgtcccttggccaggcattggaagttgtcattcagttacaagag
aagcatgtcaaagatgagcagattgaacattggaagaagatagtgaaaactcaggaagaa
ttgaaagaacttcttaacaagatggtaaatttgaaagagaaaattaaagaactccatcag
caatacaaagaagcatctgaagtaaagccgcccagagatattactgctgagttcttagtg
aaaagcaaacacagggatctgaccgccctatgcaaggagtatgatgaattagctgaaaca
caaggaaagctagaagaaaaacttcaagaattggaagcgaatcccccaagtgatgtatat
ctctcatcaagagacagacaaatacttgattggcattttgcaaatctcgaatttgctaat
gccacacctctctcaactctctcccttaagcactgggatcaggatgatgactttgagttc
actggcagccacctgacagtaaggaatggctactcatgtgtgcctgtggctttagcagaa
ggcctagacattaaactgaatacagcagtgcgacaggttcgctacacggcttcaggatgt
gaagtgatagctgtgaatacccgctccacgagtcaaacctttatttataaatgcgatgca
gttctctgtacccttcccctgggtgtgctgaagcagcagccaccagccgttcagtttgtg
ccacctctccctgagtggaaaacatctgcagtccaaaggatgggatttggcaaccttaac
aaggtggtgttgtgttttgaccgggtgttctgggatccaagtgtcaatttgttcgggcat
gttggcagtacgactgccagcaggggtgagctcttcctcttctggaacctctataaagct
ccaatactgttggcactagtggcaggagaagctgctggtatcatggaaaacataagtgac
gatgtgattgttggccgatgcctggccattctcaaagggatttttggtagcagtgcagta
ccccagcccaaggaaactgtggtgtctcgttggcgagctgatccctgggcccggggctct
tattcctatgttgctgcaggatcatctggaaatgactatgatttaatggctcagcccatc
actccaggcccctcgattccaggtgccccacagccgattccacgactcttctttgcggga
gaacatacaatccgtaactacccagccacagtgcatggtgctctgctgagtgggctgcga
gaagcaggaagaattgcagaccagtttttgggggccatgtatacgctgcctcgccaggcc
acaccaggtgttcctgcacagcagtccccaagcatgtga

DBGET integrated database retrieval system