KEGG   Macaca fascicularis (crab-eating macaque): 102136554Help
Entry
102136554         CDS       T02918                                 

Gene name
CACNG5
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 5
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04260  Cardiac muscle contraction
mcf04261  Adrenergic signaling in cardiomyocytes
mcf04921  Oxytocin signaling pathway
mcf05410  Hypertrophic cardiomyopathy (HCM)
mcf05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mcf05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102136554 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102136554 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102136554 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    102136554 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102136554 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102136554 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    102136554 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcf04040]
    102136554 (CACNG5)
Ion channels [BR:mcf04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102136554 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 COPI_assoc SUR7 DUF716 DHHC
Motif
Other DBs
NCBI-GeneID: 102136554
NCBI-ProteinID: XP_015294223
UniProt: A0A2K5TXN9
Position
16
AA seq 275 aa AA seqDB search
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctgcgggaggaaggccctgaccctgctgagcagcgtctttgctgtctgtggc
ctgggcctcctgggtatcgcggtcagcaccgactactggctgtacctggaggagggtgtg
attgtaccccagaaccagagcaccgagatcaagatgtccctgcactcaggcctctggcgg
gtctgcttccttgcaggtgaggagcgggggcgttgcttcaccattgaatatgtgatgccc
atgaacacccagctgacatccgagtccacagtcaatgttctgaagatgatccgctcagcc
acaccattccctctggtcagcctcttcttcatgttcattgggtttatcctgagcaacatt
ggacacatccgtccccaccggacaatactggcctttgtctctggcatcttctttatcctc
tcaggcctctctctcgtggtgggcctggtgctctacatctccagcatcaacgacgagatg
ctcaacaggaccaaggacgcagagacctacttcaactacaagtatgggtggtcgtttgcc
ttcgccgccatctccttccttttaacggagagtgccggggtgatgtctgtgtacctgttc
atgaagcggtacaccgcggaggacatgtacaggccccaccctggcttctaccgccctcgg
ctgagcaactgctccgattactcaggccagttcctacacccagacgcctgggtcaggggc
cgcagcccctccgacatctccagcgaggcctccctgcagatgaacagcaactaccccgcc
ttgctcaagtgccctgactatgaccagatgtcctcttcgccctgctga

DBGET integrated database retrieval system