KEGG   Macaca fascicularis (crab-eating macaque): 102137160Help
Entry
102137160         CDS       T02918                                 

Gene name
CPT2
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00071  Fatty acid degradation
mcf01212  Fatty acid metabolism
mcf03320  PPAR signaling pathway
mcf04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102137160 (CPT2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102137160 (CPT2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102137160 (CPT2)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102137160 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Tri3
Motif
Other DBs
NCBI-GeneID: 102137160
NCBI-ProteinID: XP_005543388
UniProt: Q60HG9
Position
1
AA seq 658 aa AA seqDB search
MVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDT
IRRYLSAQKPLLDDGQFRKTEQFCKNFENGIGKELHEQLVAQDKQNKHTSYISGPWFDMY
LSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRDGLLEPEVFHLNP
AKSDTDTFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKA
RHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDIWA
ELRQKLMSSGNEESLRKVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLII
AKDGSAAVHFEHSWGDGVAVLRFFNEVFKDSTQIPAITPQSQPATADSTVTVQKLNFKLT
DALKTGITAAKEKFDATMKTLTIDCLQFQRGGKEFLKKQKLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASIYTKRCSEAFVREPSRHSAGELQQMMAECSKYHG
QLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLG
GFAPVVSDGFGVGYAVHGNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggtgccccgcctgctgctgcgtgcctggccccggggccctgcggttggtccgggagcc
cccagtcggcccctcagcgccggctccgggcccggccagtacctgcagcgcagcatcgtg
cccaccatgcactaccaggacagcctgcccaggctgcctattcccaaacttgaagacacc
attaggagatacctcagtgcacagaagcctctcttggatgatggccagttcaggaaaaca
gaacaattttgcaagaattttgaaaatgggattggaaaagaactgcacgagcagctggtt
gctcaggacaaacagaataaacatacaagctacatttcaggaccctggtttgatatgtac
ctatctgctcgagactccgttgttctgaactttaatccatttatggctttcaatcctgac
ccaaaatctgagtataacgaccagctcacccgggcaaccaacatgactgtttctgccatc
cggtttctgaagacactccgggatggccttctggagccagaagtgttccatttgaaccct
gcaaaaagtgacactgacaccttcaagagactcatacgctttgtgccttcctctctgtcc
tggtatggggcctacctagtcaatgcatatcccctggatatgtcccagtattttcggctt
ttcaactcaactcgtttacccaaacccagtcgggatgaactcttcactgatgacaaggcc
agacacctcctggtcctaaggaaaggaaatttttatatctttgatgtcctggatcaagat
gggaacattgtgagcccctcagaaatccaggcgcatctgaagtacattctctcagacagc
agccccgcccccgagtttcctctggcatacctgaccagtgagaaccgagacatctgggca
gagctcaggcagaagctgatgagtagtggcaatgaggagagcctgaggaaagtggactcg
gctgtgttctgcctctgcctagatgacttccccattaaggaccttgtccacttgtcccac
aacatgctgcatggggatggcacaaaccgctggtttgataaatcctttaacctcattatc
gccaaggatggctctgctgccgtccactttgagcactcttggggtgatggtgtggcagtg
ctcagattttttaatgaagtatttaaagacagcactcagatccctgccatcactccacag
agccagccagccactgctgactctactgtcactgtgcagaaactcaacttcaagctgact
gatgccttaaagactggcatcacggctgctaaggagaagtttgatgccaccatgaaaacc
ctcactatcgactgcctccagtttcagaggggaggcaaagaattcctgaagaagcagaag
ctgagtcctgatgcagttgcccagttggccttccagatggccttcctgcggcagtacggg
cagacagtggccacctatgagtcctgtagcactgccgcattcaagcacggccgcactgag
accatccgtccggcctccatctatacaaaaaggtgctctgaggcctttgtcagggagccc
tccaggcacagtgctggcgagcttcaacagatgatggctgaatgttccaagtaccatggc
cagctgaccaaagaagcagcaatgggtcagggctttgaccgacatttgtttgctctgcgg
cacctggcagcagccaaagggatcatcttgcctgagctctacctggaccctgcatacggg
cagataaaccacaatgtcctgtccacgagcacgctgagcagcccagcagtgaaccttggg
ggctttgcccccgtggtctctgatggctttggtgttggatatgctgttcatggcaactgg
ataggctgcaatgtctcttcctacccaggccgcaatgcccgggagtttctccaatgtgtg
gagaaggccttagaagacatgtttgatgccttagaaggcaaatccatcaaaagttaa

DBGET integrated database retrieval system