KEGG   Macaca fascicularis (crab-eating macaque): 102137301
Entry
102137301         CDS       T02918                                 

Definition
(RefSeq) cytochrome P450 11B2, mitochondrial
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00140  Steroid hormone biosynthesis
mcf01100  Metabolic pathways
mcf04925  Aldosterone synthesis and secretion
Module
mcf_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102137301
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    102137301
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mcf00199]
    102137301
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     102137301
    1.14.15.5  corticosterone 18-monooxygenase
     102137301
Cytochrome P450 [BR:mcf00199]
 Cytochrome P450, animal type
  CYP11 family
   102137301
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102137301
NCBI-ProteinID: XP_005564256
UniProt: A0A2K5UPL9
Position
8
AA seq 503 aa
MALRAKAEVCMAAPWLSLQRAQALSTRAARAPSTVLPFEAIPQRPGNRWLRLLQIWREQG
YEHLHLEVHQTFQELGPIFRYHLGGPRMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALRNKVLQNA
RDSVTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSATLSFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQHYTGIVAELLLNAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGKNFHNVPFGFGMRQCLGRRLAETEMLLLLHHVLKHFLVETLTKGD
IKMVYSFILRPGTFPLLTFRAIN
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcactcagagcaaaggcagaggtgtgcatggcagcgccctggctgtccctgcaaagg
gcacaggcactaagcaccagagccgcccgggcccctagtacggtgctgccctttgaagcc
ataccccagcgtccaggcaacaggtggctgaggctgctgcagatctggagggagcagggt
tatgagcacctgcacctggaggtacatcagaccttccaggaactggggcccattttcaga
taccacttgggaggaccacgaatggtgtgtgtgatgctgccggaagacgtagagaagcta
cagcaggtggacagcctacatccccacaggatgagcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgctgaatgggcctgaatggcgcttcaat
cgattgcggctgaacccagatgtgctgtcgcccaaggctgtgcagaggttcctcccgatg
gtggatgcggtggccagggacttctcccaggccctgaggaataaggtgctgcagaacgcc
cgggacagcgtgaccctggacgtccagcccagcatcttccactacaccatagaagccagc
aacttagctctttttggagagcggctgggcctggttggtcacagccccagctctgccacc
ctgagcttcctccatgccctggaggtcatgttcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggaccagtcccaaggtgtggaaggagcattttgaggcctgg
gactgcatcttccagtacggcgacaactgtatccagaaaatctatcaggaactggccttc
agccgccctcagcactatacaggcatcgtggcggagctcctgttgaatgcagaactgtca
ctagaagccatcaaggccaactctatggaactcactgcagggagcgtggacacgacggcg
tttcccttgctgatgacactctttgagctggctcggaaccccgacgtgcagcaggccctg
cgccaggagagcctggccgccgccgccagcatcagtgaacatcctcagaaggcaaccacc
gagctgcccttgctgcgggcggccctcaaggagaccttgaggctctaccctgtgggtctg
tttttggagcgagtggtgagctcagacttggtgcttcagaactaccacatcccagccggg
acactggtgcaggttttcctctactcgctgggtcgcaaccccgccttgttcccgaggcct
gagcgctacaatccccagcgctggctagacatcaggggctctggaaagaacttccacaac
gtgccctttggctttggcatgcgccagtgcctggggcggcgcctggcagaaacggagatg
ctgctgctgctgcaccatgtgctgaaacacttcctggtggagacactaaccaaaggggat
ataaagatggtctacagcttcatactgaggcccggcacgttccccctcctcactttcaga
gcgatcaactag

DBGET integrated database retrieval system