KEGG   Macaca fascicularis (crab-eating macaque): 102137458
Entry
102137458         CDS       T02918                                 

Gene name
ADA
Definition
(RefSeq) adenosine deaminase
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00230  Purine metabolism
mcf01100  Metabolic pathways
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102137458 (ADA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102137458 (ADA)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     102137458 (ADA)
SSDB
Motif
Pfam: A_deaminase
Other DBs
NCBI-GeneID: 102137458
NCBI-ProteinID: XP_005569141
UniProt: A0A2K5VY21
Position
10
AA seq 363 aa
MTQTPAFDKPKVELHVHLDGAIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPE
FLAKFDYYMPAIAGCREAIKRIAYEFIEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVALVAQGLQEGERDFGVKARSILCCMRHQPNWSLEVVELCKKYQQQTVVAI
DLAGDETIPGSSLFPGHVEAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGY
HTLEDQALYDRLRQENMHFEICPWSSYLTGAWKPDTEHAVVRLKNDQANYSLNTDDPLIF
KSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPPASAG
QHL
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgacccagacgcccgccttcgacaagcccaaagtagaactgcacgtccacctagacgga
gccatcaagcctgaaaccatcttatactatggcaggaggagagggatcgccctcccagct
aacacagcagaggggctgctgaacgtcattggcatggacaagccgctcaccctgccggaa
ttcctggccaagtttgactactacatgcctgctattgcgggctgccgggaggctatcaaa
aggatcgcctacgagtttatagagatgaaggccaaagagggcgtggtgtatgtggaggtg
cggtacagtccgcacctgcttgccaattccaaagtggagccaatcccctggaaccaggct
gaaggggacctcaccccagacgaggtggtggccctagtggcccagggcctgcaggagggg
gagcgagacttcggggtcaaggcccggtccatcctgtgctgcatgcgccaccagcccaac
tggtccctcgaggtggtggagctgtgtaagaagtaccagcagcagaccgtggtagccatt
gacctggctggagatgagaccatcccaggaagcagcctctttcctggacatgtcgaggcc
taccaggaggctgtgaagagcggcattcaccgtactgtccacgctggggaggtgggctcg
gccgaagtagtaaaagaggctgtggatatactcaagacagagcggctgggacacggctac
cacaccctggaagaccaggccctttatgacaggctgcggcaggaaaacatgcacttcgag
atctgcccctggtccagctacctcactggtgcctggaagccggacacggagcatgcagtc
gttcggctcaaaaacgaccaggctaactactcactcaacacagacgacccgctcatcttc
aagtccaccctggacactgattaccagatgaccaaacgggacatgggctttactgaagag
gagtttaagaggctgaacatcaatgcggccaaatctagtttcctcccagaagatgagaag
agggagcttctcgacctgctctataaagcctatgggatgccacctccggcctctgcaggg
cagcacctctga

DBGET integrated database retrieval system