KEGG   Macaca fascicularis (crab-eating macaque): 102138204
Entry
102138204         CDS       T02918                                 

Gene name
RFXAP
Definition
(RefSeq) regulatory factor X associated protein
  KO
K08063  regulatory factor X-associated protein
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04612  Antigen processing and presentation
mcf05152  Tuberculosis
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102138204 (RFXAP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102138204 (RFXAP)
  09163 Immune disease
   05340 Primary immunodeficiency
    102138204 (RFXAP)
SSDB
Motif
Pfam: RFXA_RFXANK_bdg
Other DBs
NCBI-GeneID: 102138204
NCBI-ProteinID: XP_005585737
UniProt: A0A2K5VFP8
Position
17
AA seq 272 aa
MEAQGVAEGAGPGAASGVPHPAALAPAAAPALAPAPVATAASQFTLLVMQPCAGQDEAAV
PGGSVGAGKPVRYLCEGAGDGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGG
EGSSGGARRRGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSD
QALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLR
SPEVVQFLQKQQQLLNQQVLEQRQQQFPGASM
NT seq 819 nt   +upstreamnt  +downstreamnt
atggaggcgcagggtgtcgcggagggcgcggggccgggcgccgccagcggcgtgccccac
cccgcggccctagccccggctgcggctcccgccctggcgccagccccggtggcgaccgcg
gcctcgcagttcaccctgctggtgatgcaaccctgtgctgggcaggacgaggccgcggtc
cccgggggcagcgttggggcgggcaagcccgttaggtacctgtgcgaaggggccggggat
ggcgaagaggaggctggggaggacgaagcggacctgctagacacttcggaccctccaggg
ggaggtgagagcgcggctagtttggaggatctggaggacgaggagacccactcggggggc
gagggcagcagcgggggcgcccggaggcggggcagcggcgggggcagcatgagcaagacc
tgcacctacgaaggctgcagcgagaccacgagccaggtggccaagcagcgcaagccgtgg
atgtgcaagaaacaccgcaacaagatgtacaaggacaagtataaaaagaagaagagcgac
caggccctgaactgcggtgggactgcctcgactggcagcgcgggaaacgtcaaactcgag
gaaagtgcagataacatactctccattgttaaacaaagaacaggatcttttggggatcgt
cctgcaagacctactcttttagaacaagtgttaaatcaaaaaagactgtcgttactaaga
agtccagaagtagtgcaatttttacagaaacagcaacaactattaaatcagcaagttttg
gagcaaagacagcagcagtttccaggagcatcaatgtga

DBGET integrated database retrieval system