KEGG   Macaca fascicularis (crab-eating macaque): 102138630
Entry
102138630         CDS       T02918                                 

Gene name
CD40LG, CD40L
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04064  NF-kappa B signaling pathway
mcf04514  Cell adhesion molecules
mcf04660  T cell receptor signaling pathway
mcf04672  Intestinal immune network for IgA production
mcf05144  Malaria
mcf05145  Toxoplasmosis
mcf05310  Asthma
mcf05320  Autoimmune thyroid disease
mcf05322  Systemic lupus erythematosus
mcf05330  Allograft rejection
mcf05340  Primary immunodeficiency
mcf05416  Viral myocarditis
mcf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102138630 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102138630 (CD40LG)
   04514 Cell adhesion molecules
    102138630 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102138630 (CD40LG)
   04672 Intestinal immune network for IgA production
    102138630 (CD40LG)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    102138630 (CD40LG)
   05145 Toxoplasmosis
    102138630 (CD40LG)
  09163 Immune disease
   05310 Asthma
    102138630 (CD40LG)
   05322 Systemic lupus erythematosus
    102138630 (CD40LG)
   05320 Autoimmune thyroid disease
    102138630 (CD40LG)
   05330 Allograft rejection
    102138630 (CD40LG)
   05340 Primary immunodeficiency
    102138630 (CD40LG)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102138630 (CD40LG)
   05416 Viral myocarditis
    102138630 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102138630 (CD40LG)
   04090 CD molecules [BR:mcf04090]
    102138630 (CD40LG)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Tumor necrosis fators
   102138630 (CD40LG)
CD molecules [BR:mcf04090]
 Proteins
  102138630 (CD40LG)
SSDB
Motif
Pfam: TNF DUF5677
Other DBs
NCBI-GeneID: 102138630
NCBI-ProteinID: XP_005594762
UniProt: A0A2K5VW86
Position
X
AA seq 261 aa
MIETYNQPSPRSAATGLPVRMKIFMYLLTIFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGEKSLSLLNCEEIKSQFEGFVKDIMLNKEEKKKENSFEMQKGDQNP
QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN
REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
NT seq 786 nt   +upstreamnt  +downstreamnt
atgatcgaaacatacaaccaaccttctccccgatctgcggccactggactgcccgtcaga
atgaaaatttttatgtatttacttactatttttcttatcacccagatgattgggtcagca
ctttttgctgtgtatcttcatagaaggttggacaagatagaagatgaaaggaatcttcat
gaagattttgtattcatgaaaacgatacagagatgcaacacaggagaaaaatccttatcc
ttactgaactgtgaggagattaaaagccagtttgaaggcttcgtgaaggatataatgcta
aacaaagaggagaagaagaaagaaaacagctttgaaatgcaaaaaggtgatcagaatcct
caaattgcggcacatgtcataagtgaggccagtagtaaaacaacatctgtactacagtgg
gctgaaaaaggatactacaccatgagcaacaacttggtaaccctggaaaatgggaaacag
ctgaccgttaaaagacaaggactctattatatctatgcccaagtcaccttctgttccaat
cgggaagcttcgagtcaagctccatttatagccagcctctgcctaaagtcccccggtaga
ttcgagagaatcttactcagagctgcaaatacccacagttccgccaaaccttgcgggcaa
caatccattcacttgggaggagtatttgaattgcaaccaggtgcttcggtgtttgtcaat
gtgactgatccaagccaagtgagccatggcactggcttcacgtcctttggcttactcaaa
ctctga

DBGET integrated database retrieval system