KEGG   Macaca fascicularis (crab-eating macaque): 102138947
Entry
102138947         CDS       T02918                                 

Gene name
BLNK
Definition
(RefSeq) B-cell linker
  KO
K07371  B-cell linker protein
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04064  NF-kappa B signaling pathway
mcf04380  Osteoclast differentiation
mcf04662  B cell receptor signaling pathway
mcf05169  Epstein-Barr virus infection
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102138947 (BLNK)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    102138947 (BLNK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102138947 (BLNK)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102138947 (BLNK)
  09163 Immune disease
   05340 Primary immunodeficiency
    102138947 (BLNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcf04990]
    102138947 (BLNK)
Domain-containing proteins not elsewhere classified [BR:mcf04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   102138947 (BLNK)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 102138947
NCBI-ProteinID: XP_005566129
UniProt: A0A2K5VE24
Position
9
AA seq 456 aa
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADE
EEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYV
DNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPRVPPKPKGLLEDEADYVV
PVEDNDENYIHPTESSSPPPERAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPSPA
APSPLPRAGKKPMTPLKTTPVASQQNTSSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQ
KQLHQKPIPLPRFTEGGNPTVDGPVPSFSSNSTISEQEAGVLCKPWYAGDCDRKSAEEAL
HRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFG
SVAEIIKNHQHSPLVLIDSQNNTKDSTRLKYAVKVS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggacaagcttaataaaataaccgtccccgccagtcagaagttgaggcagcttcaaaag
atggtccatgatattaaaaacaatgaaggtggaataatgaataaaatcaaaaagctaaaa
gtcaaagcacctccaagtgttcctcgaagggactacgcttcagagagccccgctgacgaa
gaggagcagtggtccgatgactttgacagcgactatgaaaatccagacgagcactccgac
tcagagatgtacgtgatgcccgccgaggagaatgctgatgacagctacgagccgcctccg
gtagagcaggagaccaggccggttcacccagccctgcccttcgccaggggcgagtacgta
gacaatcgatcaagccagaggcattccccacccttcagcaagacacttcccagtaagccc
agctggccttcagagaaagcaaggctcacctccaccctgccggccctgactgctctgcag
aaacctcgagtcccacccaaacccaaaggcctccttgaggatgaggctgattatgtggtc
cccgtagaagataatgatgaaaactatattcatcccacagaaagcagttcacctccacct
gaaagagctcccatggtgaatagatcaaccaagccaaattcctcaacgcccgcctctcct
ccaggaacagcttcaggtcgaaacagtggggcctgggaaaccaagtcaccttcaccagct
gcgccatccccgttgccacgggccgggaaaaaaccaatgacaccactgaagactactcca
gttgcctctcaacagaatacttcaagtgtttgtgaagaaaaacctatacctgctgaacgc
caccgagggtcaagtcacagacaagaagctgtgcagtcaccagtgtttcctcccgcccag
aaacaactccaccaaaaacccatacctctgccaagatttacagaagggggaaacccaact
gtggatgggcccgtacccagtttttcatctaactccactatttcagaacaggaagctggc
gttctctgtaagccatggtatgctggtgactgtgaccgaaagtctgctgaagaggcattg
cacagatcaaacaaggatggatcatttcttattcggaaaagctctggccatgattccaaa
caaccatatacactagttgtattctttaacaagcgagtatataatattcctgtgcggttt
attgaagcaacgaaacaatatgccttgggcagaaagaaaaatggtgaagagtactttgga
agtgttgctgaaatcatcaagaatcatcaacatagtcctttggttcttattgacagtcag
aataacacaaaagattccaccagactgaagtatgcagttaaagtttcataa

DBGET integrated database retrieval system