KEGG   Macaca fascicularis (crab-eating macaque): 102139456
Entry
102139456         CDS       T02918                                 

Gene name
CCR5, CC-CKR-5, CCR-5, CMKBR5
Definition
(RefSeq) C-C motif chemokine receptor 5
  KO
K04180  C-C chemokine receptor type 5
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04061  Viral protein interaction with cytokine and cytokine receptor
mcf04062  Chemokine signaling pathway
mcf04144  Endocytosis
mcf05145  Toxoplasmosis
mcf05163  Human cytomegalovirus infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102139456 (CCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102139456 (CCR5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102139456 (CCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102139456 (CCR5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102139456 (CCR5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102139456 (CCR5)
   05163 Human cytomegalovirus infection
    102139456 (CCR5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102139456 (CCR5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102139456 (CCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcf04030]
    102139456 (CCR5)
   04050 Cytokine receptors [BR:mcf04050]
    102139456 (CCR5)
   04090 CD molecules [BR:mcf04090]
    102139456 (CCR5)
G protein-coupled receptors [BR:mcf04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    102139456 (CCR5)
Cytokine receptors [BR:mcf04050]
 Chemokine receptors
  CC Chemokine
   102139456 (CCR5)
CD molecules [BR:mcf04090]
 Proteins
  102139456 (CCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx T4SS_pilin
Other DBs
NCBI-GeneID: 102139456
NCBI-ProteinID: NP_001306312
UniProt: P61814 G7NY33
Position
2
AA seq 352 aa
MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR
LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS
HFPYSQYQFWKNFQTLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggactatcaagtgtcaagtccaacctatgacatcgattattatacatcggaaccctgc
caaaaaatcaatgtgaaacaaatcgcagcccgcctcctgcctccgctctactcactggtg
ttcatctttggttttgtgggcaacatactggtcgtcctcatcctgataaactgcaaaagg
ctgaaaagcatgactgacatctacctgctcaacctggccatctctgacctgcttttcctt
cttactgtccccttctgggctcactatgctgccgcccagtgggactttggaaatacaatg
tgtcaactcttgacagggctctattttataggcttcttctctggaatcttcttcatcatc
ctcctgacaatcgataggtacctggctatcgtccatgctgtgtttgctttaaaagccagg
acagtcacctttggggtggtgacaagtgtgatcacttgggtggtggctgtgtttgcctct
ctcccaggaatcatctttaccagatctcagagagaaggtcttcattacacctgcagctct
cattttccatacagtcagtatcaattctggaagaattttcagacattaaagatggtcatc
ttggggctggtcctgccgctgcttgtcatggtcatctgctactcgggaatcctgaaaact
ctgcttcggtgtcgaaacgagaagaagaggcacagggctgtgaggcttatcttcaccatc
atgattgtttattttctcttctgggctccctacaacattgtccttctcctgaacaccttc
caggaattctttggcctgaataattgcagtagctctaacaggttggaccaagccatgcag
gtgacagagactcttgggatgacacactgctgcatcaaccccatcatctatgccttcgtc
ggggagaagttcagaaactacctcttagtcttcttccaaaagcacattgccaaacgcttc
tgcaaatgctgttccattttccagcaagaggctcccgagcgagcaagttcagtttacacc
cgatccactggggagcaggaaatatctgtgggcttgtga

DBGET integrated database retrieval system